Project name: query_structure

Status: done

Started: 2026-03-17 00:16:44
Settings
Chain sequence(s) A: GIPCGESCVWIPCISSAIGCSCKSKVCYRN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:08)
Show buried residues

Minimal score value
-1.649
Maximal score value
2.9527
Average score
0.2853
Total score value
8.5596

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.5987
2 I A 0.9960
3 P A 0.0541
4 C A 0.0618
5 G A -0.4349
6 E A -0.0515
7 S A 0.3460
8 C A 0.0000
9 V A 2.0724
10 W A 2.6721
11 I A 2.9527
12 P A 1.6380
13 C A 0.0000
14 I A 2.3132
15 S A 1.1918
16 S A 0.9376
17 A A 1.2223
18 I A 1.8394
19 G A -0.0016
20 C A 0.0000
21 S A -0.7163
22 C A -0.4713
23 K A -1.6490
24 S A -1.1600
25 K A -0.7909
26 V A -0.6713
27 C A 0.0000
28 Y A -0.6678
29 R A -1.0632
30 N A -1.4613
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018