Project name: query_structure

Status: done

Started: 2026-03-17 01:12:55
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVVLYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAQYESGTWLYRGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)
Show buried residues

Minimal score value
-3.0649
Maximal score value
1.7509
Average score
-0.5487
Total score value
-51.5824

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7509
2 S A 0.5729
3 D A -0.0068
4 V A -0.3265
5 P A 0.0000
6 R A -2.6861
7 D A -3.0649
8 L A 0.0000
9 E A -2.0212
10 V A 0.0780
11 V A 1.5234
12 A A 0.8852
13 A A 0.2991
14 T A -0.5282
15 P A -1.1309
16 T A -1.0003
17 S A -0.5343
18 L A 0.0000
19 L A 0.7240
20 I A 0.0000
21 S A -0.9525
22 W A 0.0000
23 D A -2.3082
24 A A -1.1590
25 P A 0.0000
26 A A 0.3757
27 V A 0.5265
28 T A -0.0028
29 V A 0.0697
30 V A 0.6769
31 L A -0.0224
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A -0.5077
36 Y A 0.0000
37 G A 0.0000
38 E A -1.7951
39 T A -1.5154
40 G A -1.3560
41 G A -1.5161
42 N A -1.5550
43 S A -0.8832
44 P A -0.3523
45 V A 0.3871
46 Q A -0.9010
47 E A -1.5915
48 F A -0.6079
49 T A -0.2164
50 V A 0.0000
51 P A -0.5531
52 G A -0.2996
53 S A -0.8682
54 K A -1.7459
55 S A -1.1675
56 T A -0.6333
57 A A 0.0000
58 T A 0.2325
59 I A 0.0000
60 S A -0.6592
61 G A -1.0286
62 L A 0.0000
63 K A -2.4594
64 P A -1.7520
65 G A -1.5992
66 V A -1.7299
67 D A -2.8136
68 Y A 0.0000
69 T A -0.9858
70 I A 0.0000
71 T A -0.1433
72 V A 0.0000
73 Y A -0.2652
74 A A 0.0000
75 Q A -0.4124
76 Y A -0.2210
77 E A -1.0412
78 S A -0.4636
79 G A -0.4373
80 T A 0.1218
81 W A 0.8641
82 L A 0.6635
83 Y A 0.0918
84 R A -1.3845
85 G A 0.0000
86 S A -0.4247
87 P A -0.4013
88 I A -0.1147
89 S A -0.3514
90 I A -0.7347
91 N A -1.9060
92 Y A -1.6682
93 R A -2.8266
94 T A -1.7924
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018