Project name: GLP-1

Chain sequence(s)	A: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)

• Minimal score value: -2.1171
• Maximal score value: 2.05
• Average score: -0.1762
• Total score value: -5.4607

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
98	H	A	-1.3967
99	A	A	-1.4591
100	E	A	-2.1171
101	G	A	-1.1486
102	T	A	-0.2066
103	F	A	1.2552
104	T	A	0.5194
105	S	A	0.2656
106	D	A	-0.3320
107	V	A	1.4972
108	S	A	0.7539
109	S	A	0.2126
110	Y	A	1.1293
111	L	A	0.7120
112	E	A	-1.3667
113	G	A	-0.9725
114	Q	A	-1.4395
115	A	A	-0.9906
116	A	A	-0.7043
117	K	A	-1.7065
118	E	A	-1.1617
119	F	A	1.5421
120	I	A	2.0500
121	A	A	0.7941
122	W	A	0.7558
123	L	A	1.3094
124	V	A	1.5322
125	K	A	-0.7562
126	G	A	-1.3053
127	R	A	-2.0661
128	G	A	-0.6600