Project name: query_structure

Status: done

Started: 2026-03-16 20:10:08
Settings
Chain sequence(s) A: EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)
Show buried residues

Minimal score value
-3.3332
Maximal score value
2.6814
Average score
-0.6424
Total score value
-55.2458

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.1866
2 V A 0.6311
3 V A 1.7199
4 A A 0.9895
5 A A 0.3439
6 T A -0.5334
7 P A -1.1239
8 T A -0.9964
9 S A -0.5321
10 L A 0.0000
11 L A 0.8756
12 I A 0.0000
13 S A -0.4222
14 W A 0.0000
15 R A -2.4345
16 H A -1.4533
17 P A -0.8823
18 H A -0.8627
19 F A 0.1986
20 P A -0.7329
21 T A -0.8716
22 R A -2.2845
23 Y A -1.0027
24 Y A 0.0000
25 R A -0.3966
26 I A 0.0000
27 T A 0.0000
28 Y A -0.3959
29 G A 0.0000
30 E A -1.6746
31 T A -1.2921
32 G A -1.2670
33 G A -1.4476
34 N A -1.5666
35 S A -0.9199
36 P A -0.4310
37 V A 0.2473
38 Q A -1.2080
39 E A -1.7943
40 F A -0.7337
41 T A -0.2524
42 V A 0.0000
43 P A -0.6914
44 L A -0.5507
45 Q A -1.3176
46 P A -1.1100
47 P A -0.9398
48 T A -0.3732
49 A A 0.0000
50 T A 0.2286
51 I A 0.0000
52 S A -0.6606
53 G A -1.0373
54 L A 0.0000
55 K A -2.3922
56 P A -1.6762
57 G A -1.4565
58 V A -1.4524
59 D A -2.1144
60 Y A 0.0000
61 T A -0.7524
62 I A 0.0000
63 T A 0.2564
64 V A 0.0000
65 Y A 1.1679
66 A A 0.0000
67 V A 0.0000
68 T A -1.6169
69 D A -3.3332
70 G A -2.6182
71 R A -3.1672
72 N A -2.8968
73 G A -2.5668
74 R A -2.8544
75 L A -0.4671
76 L A 1.3492
77 S A 1.8533
78 I A 2.6814
79 P A 1.8515
80 I A 1.7815
81 S A 0.5540
82 I A -0.0658
83 N A -1.6261
84 Y A -1.4232
85 R A -2.5704
86 T A -1.5459
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018