Project name: 7e2908e93bfd365

Status: done

Started: 2026-03-31 12:19:06
Settings
Chain sequence(s) A: SDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRIAVSYQTPVNLLSAIRSPCQANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:14)
Show buried residues

Minimal score value
-3.227
Maximal score value
2.1844
Average score
-0.5929
Total score value
-83.5931

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
9 S A -1.0214
10 D A -1.9126
11 M A -0.2895
12 P A 0.0000
13 V A 0.3703
14 A A 0.0000
15 H A 0.0258
16 V A 0.0000
17 V A -0.5992
18 A A 0.0000
19 N A -1.2658
20 P A -1.5442
21 Q A -2.0895
22 A A -2.1002
23 E A -3.2270
24 G A -2.8991
25 Q A -2.8043
26 L A 0.0000
27 Q A -1.9315
28 W A 0.0000
29 L A -0.8114
30 N A -1.4954
31 R A -2.3837
32 R A -2.0422
33 A A -1.2988
34 N A -1.6837
35 A A -0.9951
36 L A 0.0129
37 L A -0.0207
38 A A -0.5403
39 N A -1.4259
40 G A -1.2199
41 V A 0.0000
42 E A -2.0454
43 L A -1.8655
44 R A -3.0569
45 D A -3.1762
46 N A -2.5747
47 Q A -2.2279
48 L A 0.0000
49 V A 0.0000
50 V A 0.0000
51 P A -1.3691
52 S A -1.5028
53 E A -2.5950
54 G A -0.8608
55 L A 0.7504
56 Y A 0.0000
57 L A 1.6292
58 I A 0.0000
59 Y A 0.5504
60 S A 0.0000
61 Q A 0.2638
62 V A 0.0000
63 L A 0.0000
64 F A 0.0000
65 S A -0.0551
66 G A -0.7652
67 Q A -1.4821
68 G A -0.8948
69 C A -0.3055
70 P A -0.4297
71 S A -0.5021
72 T A -0.6508
73 H A -1.1206
74 V A 0.0000
75 L A 0.4268
76 L A 0.0000
77 T A 0.0945
78 H A 0.0000
79 T A -0.4167
80 I A 0.0000
81 S A 0.0000
82 R A -0.3008
83 I A -0.1155
84 A A 0.2574
85 V A 0.6640
86 S A 0.5333
87 Y A 1.0970
88 Q A -0.2478
89 T A -0.1212
90 P A -0.3053
91 V A 0.1699
92 N A -0.8591
93 L A -0.1101
94 L A -0.0573
95 S A 0.0153
96 A A 0.9123
97 I A 1.5797
98 R A -0.1187
99 S A -0.4560
100 P A -0.3831
101 C A 0.0000
102 Q A -1.4312
111 A A -0.8710
112 N A -1.6454
113 P A -0.9954
114 W A -0.0096
115 Y A 0.8790
116 E A -0.0550
117 P A -0.0163
118 I A 0.0000
119 Y A 1.1246
120 L A 0.0000
121 G A 0.3074
122 G A 0.6529
123 V A 1.7106
124 F A 0.6649
125 Q A -0.8808
126 L A 0.0000
127 E A -2.1279
128 P A -1.4122
129 G A -0.8472
130 D A 0.0000
131 R A -1.6713
132 L A 0.0000
133 S A -1.2584
134 A A 0.0000
135 E A -1.9870
136 I A -1.3235
137 N A -1.6161
138 R A -1.8592
139 P A -2.4956
140 D A -2.8155
141 Y A -1.2580
142 L A -0.9015
143 D A -0.7168
144 F A -0.9799
145 A A -0.8764
146 E A -2.0138
147 S A -1.4539
148 G A -1.1479
149 Q A -0.8694
150 V A 0.0000
151 Y A 0.1353
152 F A 0.0000
153 G A 0.0000
154 I A 0.0000
155 I A 1.5042
156 A A 0.0000
157 L A 2.1844
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018