Project name: obj1 [mutate: EC6C, GI10C, WM47C, YV95C, GI113C, LH115C, TV117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	WM47C,YV95C,TV117C,LH115C,GI10C,GI113C,EC6C
Energy difference between WT (input) and mutated protein (by FoldX)	15.2383 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:33)

• Minimal score value: -3.3453
• Maximal score value: 2.5877
• Average score: -0.616
• Total score value: -73.915

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0224
2	V	C	-0.9527
3	Q	C	-1.1324
4	L	C	0.0000
5	V	C	1.4226
6	C	C	0.7548	mutated: EC6C
7	S	C	-0.0181
8	G	C	-0.5667
9	G	C	0.6543
10	I	C	2.5877	mutated: GI10C
11	L	C	2.2833
12	V	C	0.5633
13	Q	C	-1.2919
14	P	C	-1.4527
15	G	C	-1.4159
16	G	C	-0.9937
17	S	C	-1.2448
18	L	C	-0.6516
19	R	C	-2.1340
20	L	C	0.0000
21	S	C	-0.3577
22	C	C	0.0000
23	A	C	0.0615
24	A	C	0.0000
25	S	C	-0.1293
26	D	C	0.0000
27	F	C	1.5423
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.1576
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.8859
40	A	C	-1.3970
41	P	C	-1.3646
42	G	C	-1.5030
43	K	C	-2.2688
44	G	C	-1.3078
45	L	C	-0.1284
46	E	C	-0.6194
47	M	C	0.2398	mutated: WM47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5478
53	G	C	-1.2460
54	S	C	-1.2291
55	G	C	-1.0820
56	G	C	-0.7344
57	S	C	-0.2351
58	T	C	0.3579
59	Y	C	0.9367
60	Y	C	-0.1552
61	A	C	-1.0415
62	D	C	-2.2973
63	S	C	-1.7064
64	V	C	0.0000
65	K	C	-2.3267
66	G	C	-1.6104
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6299
70	I	C	0.0000
71	S	C	-0.5622
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6476
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6393
81	L	C	0.0000
82	Q	C	-1.2395
83	M	C	0.0000
84	N	C	-1.3377
85	S	C	-1.2348
86	L	C	0.0000
87	R	C	-2.4235
88	A	C	-1.8083
89	E	C	-2.2897
90	D	C	0.0000
91	T	C	-0.4993
92	A	C	0.0000
93	I	C	0.2821
94	Y	C	0.0000
95	V	C	0.0000	mutated: YV95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.2123
101	D	C	-3.3453
102	G	C	-2.1017
103	F	C	-1.2182
104	N	C	-2.4446
105	K	C	-3.2014
106	G	C	-1.9397
107	F	C	-1.0485
108	D	C	-1.1244
109	Y	C	-0.2381
110	W	C	0.7601
111	G	C	0.4473
112	Q	C	-0.2338
113	I	C	0.6574	mutated: GI113C
114	T	C	0.3713
115	H	C	0.2468	mutated: LH115C
116	V	C	0.0000
117	V	C	0.7667	mutated: TV117C
118	V	C	0.0000
119	S	C	-0.6814
120	S	C	-1.0137