Project name: nfFerritin

Status: done

Started: 2026-03-05 12:22:22
Settings
Chain sequence(s) A: RYNYSSECEQLVNEQINHELNASYFYTALGTYYSQPTVALPGVANYFLAQSNEERRHAHALIQYQNGRGGKVQFSAIQAPPDFSKVLTGGEAATVTTRGFELAIETERMVYDKIRYIYQVAESQRDFALTGFLQKLIDEQVESLRELQELYTKSKRMVNEYWFDQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:17)
Show buried residues

Minimal score value
-3.1884
Maximal score value
1.268
Average score
-0.8623
Total score value
-142.2736

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 R A -1.9579
2 Y A -0.3293
3 N A -1.3347
4 Y A 0.0000
5 S A -1.4856
6 S A -1.7503
7 E A -2.3405
8 C A 0.0000
9 E A -2.1916
10 Q A -2.5655
11 L A 0.0000
12 V A 0.0000
13 N A 0.0000
14 E A -1.3795
15 Q A 0.0000
16 I A 0.0000
17 N A 0.0000
18 H A -0.5026
19 E A 0.0000
20 L A -0.2123
21 N A -0.0072
22 A A 0.0000
23 S A 0.0000
24 Y A 0.5975
25 F A 0.5368
26 Y A 0.0000
27 T A 0.1820
28 A A 0.0843
29 L A 0.0000
30 G A 0.0000
31 T A -0.2568
32 Y A -0.3730
33 Y A 0.0000
34 S A -0.6464
35 Q A -0.6582
36 P A -0.4823
37 T A -0.2052
38 V A 0.0030
39 A A -0.1133
40 L A 0.0000
41 P A -0.9017
42 G A -0.9437
43 V A 0.0000
44 A A 0.0000
45 N A -1.1661
46 Y A -0.3350
47 F A 0.0000
48 L A -0.1623
49 A A -0.7385
50 Q A 0.0000
51 S A 0.0000
52 N A -2.3066
53 E A -2.7102
54 E A 0.0000
55 R A -2.7010
56 R A -3.1884
57 H A 0.0000
58 A A 0.0000
59 H A -2.0714
60 A A -1.2551
61 L A 0.0000
62 I A -1.3613
63 Q A -1.7418
64 Y A -1.0519
65 Q A 0.0000
66 N A -2.6054
67 G A -2.0062
68 R A -1.9395
69 G A -2.0541
70 G A -2.3241
71 K A -2.3973
72 V A -1.3928
73 Q A -0.9391
74 F A 1.1229
75 S A 0.3669
76 A A 0.4713
77 I A 0.5706
78 Q A -0.7242
79 A A -0.4725
80 P A -0.5055
81 P A -1.3791
82 D A -2.3551
83 F A 0.0000
84 S A -1.5087
85 K A -2.3381
86 V A -1.2425
87 L A 0.0000
88 T A -1.0083
89 G A -1.3621
90 G A -1.5296
91 E A -2.1609
92 A A -1.4089
93 A A -0.9221
94 T A -0.4543
95 V A 0.0462
96 T A 0.0000
97 T A 0.0000
98 R A -0.7067
99 G A 0.0000
100 F A 0.0000
101 E A -0.7653
102 L A -0.6591
103 A A 0.0000
104 I A -1.5038
105 E A -2.1249
106 T A -1.1172
107 E A 0.0000
108 R A -2.0293
109 M A -1.4235
110 V A 0.0000
111 Y A -1.2269
112 D A -1.8970
113 K A -1.6356
114 I A 0.0000
115 R A -2.0656
116 Y A -0.7670
117 I A 0.0000
118 Y A -1.0957
119 Q A -1.9006
120 V A -1.5441
121 A A 0.0000
122 E A -1.9993
123 S A -1.8555
124 Q A -2.7087
125 R A -2.5644
126 D A 0.0000
127 F A 0.8326
128 A A 0.4619
129 L A 0.0000
130 T A 0.0000
131 G A -0.0778
132 F A -0.0327
133 L A 0.0000
134 Q A -2.0079
135 K A -2.6112
136 L A 0.0000
137 I A -1.7167
138 D A -2.5014
139 E A -1.9865
140 Q A 0.0000
141 V A -0.5919
142 E A -2.2012
143 S A -1.8659
144 L A 0.0000
145 R A -2.9520
146 E A -2.5668
147 L A 0.0000
148 Q A -2.7658
149 E A -3.1196
150 L A -1.9322
151 Y A -2.0120
152 T A -2.3311
153 K A -2.7889
154 S A 0.0000
155 K A -2.5375
156 R A -2.5852
157 M A -0.5186
158 V A 1.0081
159 N A 0.1066
160 E A 0.1269
161 Y A 1.0153
162 W A 1.2680
163 F A -0.0496
164 D A -0.4501
165 Q A -0.8241
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018