Project name: 7f3e6304e935d1f

Chain sequence(s)	H: EVLLVESGGGLVKPGGSLKLSCAASGFTFRTSAMSWVRQTPERRLEWVASISSGGSYTFYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAIYYCARDYDSYDYAMDYWGQGTSVAVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)

• Minimal score value: -3.5249
• Maximal score value: 1.4497
• Average score: -0.5058
• Total score value: -60.7004

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	H	-1.6276
2	V	H	-0.2343
3	L	H	0.6169
4	L	H	0.0000
5	V	H	1.0629
6	E	H	0.0000
7	S	H	-0.4711
8	G	H	-0.9279
9	G	H	-0.3410
10	G	H	0.3006
11	L	H	1.1154
12	V	H	-0.2802
13	K	H	-1.8837
14	P	H	-1.8911
15	G	H	-1.5137
16	G	H	-0.9901
17	S	H	-1.0996
18	L	H	-0.7340
19	K	H	-1.8788
20	L	H	0.0000
21	S	H	-0.3115
22	C	H	0.0000
23	A	H	0.1345
24	A	H	0.0000
25	S	H	-0.3559
26	G	H	-0.7041
27	F	H	-0.4350
28	T	H	-0.7067
29	F	H	0.0000
30	R	H	-2.5101
31	T	H	-1.3199
32	S	H	0.0000
33	A	H	-0.6064
34	M	H	0.0000
35	S	H	0.0000
36	W	H	0.0000
37	V	H	0.0000
38	R	H	0.0000
39	Q	H	-1.2521
40	T	H	0.0000
41	P	H	-2.1577
42	E	H	-3.3223
43	R	H	-3.5249
44	R	H	-2.9727
45	L	H	-0.6489
46	E	H	-0.2824
47	W	H	0.4435
48	V	H	0.0000
49	A	H	0.0000
50	S	H	0.5460
51	I	H	0.0000
52	S	H	-0.0742
53	S	H	-0.9189
54	G	H	-1.0579
55	G	H	-0.5823
56	S	H	0.1401
57	Y	H	1.2887
58	T	H	1.0929
59	F	H	1.0488
60	Y	H	-0.3156
61	P	H	-1.0977
62	D	H	-2.4245
63	S	H	-1.7522
64	V	H	0.0000
65	K	H	-2.4657
66	G	H	-1.7132
67	R	H	-1.4723
68	F	H	0.0000
69	T	H	-0.6152
70	I	H	0.0000
71	S	H	-0.2812
72	R	H	-1.1908
73	D	H	-1.7159
74	N	H	-2.1675
75	A	H	-1.5922
76	K	H	-2.4213
77	N	H	-1.9569
78	T	H	-1.1199
79	L	H	0.0000
80	Y	H	-0.3511
81	L	H	0.0000
82	Q	H	-1.0524
83	M	H	0.0000
84	S	H	-0.9906
85	S	H	-1.1408
86	L	H	0.0000
87	R	H	-2.7363
88	S	H	-2.2010
89	E	H	-2.5014
90	D	H	0.0000
91	T	H	-0.7541
92	A	H	0.0000
93	I	H	0.2365
94	Y	H	0.0000
95	Y	H	0.2968
96	C	H	0.0000
97	A	H	0.0000
98	R	H	-0.1405
99	D	H	-0.1481
100	Y	H	0.6300
101	D	H	-0.9745
102	S	H	0.0767
103	Y	H	1.2053
104	D	H	0.5979
105	Y	H	1.4497
106	A	H	1.0316
107	M	H	0.8456
108	D	H	0.4351
109	Y	H	1.1444
110	W	H	0.8192
111	G	H	0.3706
112	Q	H	-0.6095
113	G	H	0.0000
114	T	H	-0.1531
115	S	H	0.0019
116	V	H	0.0000
117	A	H	-0.1387
118	V	H	0.0000
119	S	H	-0.9286
120	S	H	-0.8922