Project name: query_structure

Status: done

Started: 2026-03-16 22:49:17
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVSGSKSTATISGLKPGVDYTITVYAKYLFWSGYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-2.6612
Maximal score value
3.0187
Average score
-0.2491
Total score value
-22.916

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7772
2 S A 0.7736
3 S A 0.5905
4 V A 0.4446
5 P A 0.0000
6 T A -1.6311
7 K A -2.6612
8 L A 0.0000
9 E A -1.9135
10 V A 0.0992
11 V A 1.5328
12 A A 0.8900
13 A A 0.3014
14 T A -0.3384
15 P A -1.1049
16 T A -0.9913
17 S A -0.5279
18 L A 0.0000
19 L A 0.7278
20 V A 0.0000
21 S A -0.9252
22 W A 0.0000
23 D A -2.5839
24 A A -1.1980
25 P A 0.0043
26 A A 0.4392
27 V A 0.8148
28 T A 0.8146
29 V A 1.0239
30 V A 1.5061
31 F A 1.3534
32 Y A 0.0000
33 D A -0.0477
34 I A 0.0000
35 T A -0.5729
36 Y A -0.3995
37 G A 0.0000
38 E A -1.5785
39 T A -1.2384
40 G A -1.2319
41 G A -1.4075
42 N A -1.5463
43 S A -0.9248
44 P A -0.4211
45 V A 0.2584
46 Q A -1.1787
47 E A -1.7434
48 F A -0.5955
49 T A 0.0922
50 V A 0.2883
51 S A 0.0234
52 G A 0.0856
53 S A -0.5670
54 K A -1.4296
55 S A -1.0897
56 T A -0.6214
57 A A 0.0000
58 T A 0.2619
59 I A 0.0000
60 S A -0.6578
61 G A -1.0251
62 L A 0.0000
63 K A -2.3551
64 P A -1.6363
65 G A -1.4280
66 V A -1.3820
67 D A -2.0656
68 Y A 0.0000
69 T A -0.7623
70 I A 0.0000
71 T A -0.1253
72 V A 0.0000
73 Y A 0.5411
74 A A 0.0000
75 K A 0.9848
76 Y A 0.0000
77 L A 2.7823
78 F A 3.0187
79 W A 2.2220
80 S A 1.0116
81 G A 0.8639
82 Y A 1.0602
83 S A 0.4814
84 S A 0.0933
85 P A 0.2178
86 I A 0.0921
87 S A -0.5002
88 I A -0.7230
89 N A -1.7173
90 Y A -1.4345
91 R A -2.4921
92 T A -1.6145
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018