Project name: query_structure

Status: done

Started: 2026-03-17 01:17:35
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWYYPFCAFYYRITYGETGGNSPVQEFTVRYYRITYGETGGNSPVQEFTVPRSYKAPSATISGLKPGVDYTITVYAATCLGSYSRPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)
Show buried residues

Minimal score value
-2.5551
Maximal score value
1.7424
Average score
-0.4927
Total score value
-55.6718

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.2803
2 S A -0.4970
3 D A -1.5950
4 V A -1.2855
5 P A 0.0000
6 R A -2.2270
7 D A -2.5312
8 L A 0.0000
9 E A -1.7766
10 V A 0.1040
11 V A 1.5568
12 A A 0.9116
13 A A 0.3050
14 T A -0.3428
15 P A -1.1405
16 T A -0.9935
17 S A -0.5209
18 L A 0.0000
19 L A 0.7908
20 I A 0.0000
21 S A -0.5219
22 W A 0.0000
23 Y A -0.2306
24 Y A 0.0000
25 P A 0.4223
26 F A 0.8901
27 C A 1.4298
28 A A 1.3095
29 F A 1.0131
30 Y A 0.1322
31 Y A 0.0000
32 R A -0.9140
33 I A 0.0000
34 T A -0.5448
35 Y A -0.2581
36 G A 0.0000
37 E A -1.4902
38 T A -1.2186
39 G A -1.2191
40 G A -1.3268
41 N A -1.5157
42 S A -0.8071
43 P A -0.2890
44 V A 0.4901
45 Q A -0.7936
46 E A -1.6914
47 F A -0.9101
48 T A -0.6240
49 V A -0.2840
50 R A -1.2050
51 Y A 0.3350
52 Y A 0.2610
53 R A -0.8931
54 I A 0.5022
55 T A 0.0393
56 Y A 0.6665
57 G A -0.8437
58 E A -2.0882
59 T A -1.3699
60 G A -1.7172
61 G A -1.8493
62 N A -1.7689
63 S A -1.1857
64 P A -0.6295
65 V A 0.3519
66 Q A -1.1338
67 E A -1.3875
68 F A -0.2674
69 T A -0.4891
70 V A -0.0098
71 P A -0.5498
72 R A -1.5355
73 S A -0.8459
74 Y A 0.0159
75 K A -1.2686
76 A A -0.5085
77 P A -0.0872
78 S A 0.0793
79 A A 0.0000
80 T A 0.2803
81 I A 0.0000
82 S A -0.6553
83 G A -1.0326
84 L A 0.0000
85 K A -2.3752
86 P A -1.6708
87 G A -1.4595
88 V A -1.4571
89 D A -2.0943
90 Y A 0.0000
91 T A -0.7168
92 I A 0.0000
93 T A -0.1797
94 V A 0.0000
95 Y A -0.0034
96 A A 0.0000
97 A A 0.0000
98 T A 0.0000
99 C A 1.6098
100 L A 1.7424
101 G A 0.5807
102 S A 0.1668
103 Y A 0.2286
104 S A 0.0000
105 R A -1.9401
106 P A -1.0161
107 I A -0.6595
108 S A -0.6635
109 I A -0.7352
110 N A -1.7316
111 Y A -1.5032
112 R A -2.5551
113 T A -1.5355
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018