Project name: 7febbb91f1f5558

Chain sequence(s)	A: QVQLVESGGGSVQAGGSLRLSCTASGFTFSSFGLGWFRQAPGQEREAVAAISSGSSTIYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:53)

• Minimal score value: -3.6063
• Maximal score value: 1.1906
• Average score: -0.801
• Total score value: -102.5309

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.4920
2	V	A	-0.9133
3	Q	A	-1.0178
4	L	A	0.0000
5	V	A	1.1906
6	E	A	0.0000
7	S	A	-0.4426
8	G	A	-1.2488
9	G	A	-1.1624
10	G	A	-0.9484
11	S	A	-0.7316
12	V	A	-0.8204
13	Q	A	-1.7376
14	A	A	-1.7996
15	G	A	-1.7469
16	G	A	-1.3335
17	S	A	-1.4029
18	L	A	-1.2005
19	R	A	-2.1098
20	L	A	0.0000
21	S	A	-0.4530
22	C	A	0.0000
23	T	A	-0.1950
24	A	A	0.0000
25	S	A	-0.8701
26	G	A	-1.0012
27	F	A	-0.3275
28	T	A	-0.1575
29	F	A	0.0000
30	S	A	-0.7779
31	S	A	-0.5761
32	F	A	-0.3229
33	G	A	-0.4894
34	L	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-1.8636
40	A	A	-1.7393
41	P	A	-1.1976
42	G	A	-1.6869
43	Q	A	-2.8210
44	E	A	-3.2815
45	R	A	-2.3785
46	E	A	-1.9270
47	A	A	0.0000
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.0000
51	I	A	0.0000
52	S	A	0.0000
53	S	A	-1.0161
54	G	A	-0.8089
55	S	A	-0.5090
56	S	A	-0.4755
57	T	A	-0.1483
58	I	A	0.9057
59	Y	A	0.2145
60	Y	A	-0.4899
61	A	A	-1.4003
62	D	A	-2.4545
63	S	A	-1.7667
64	V	A	0.0000
65	K	A	-2.5803
66	G	A	-1.8668
67	R	A	-1.7614
68	F	A	0.0000
69	T	A	-0.6324
70	I	A	0.0000
71	S	A	-0.3740
72	R	A	-1.1917
73	D	A	-1.7362
74	N	A	-1.8469
75	A	A	-1.4424
76	K	A	-2.3155
77	N	A	-1.6904
78	T	A	-1.0558
79	V	A	0.0000
80	T	A	-0.7527
81	L	A	0.0000
82	Q	A	-1.1373
83	M	A	0.0000
84	N	A	-1.7776
85	N	A	-2.2032
86	L	A	0.0000
87	K	A	-2.2752
88	P	A	-1.7487
89	E	A	-2.2151
90	D	A	0.0000
91	T	A	-1.0736
92	A	A	0.0000
93	I	A	-0.3727
94	Y	A	0.0000
95	Y	A	-0.1964
96	C	A	0.0000
97	A	A	0.0000
98	A	A	0.0000
99	A	A	0.0000
100	G	A	0.3004
101	V	A	0.5078
102	R	A	-1.9777
103	A	A	-2.5144
104	E	A	-3.3234
105	D	A	-3.6063
106	G	A	-2.9681
107	R	A	-2.9692
108	V	A	0.0000
109	R	A	-0.5277
110	T	A	0.0416
111	L	A	0.8464
112	P	A	-0.2105
113	S	A	-0.0701
114	E	A	-0.0015
115	Y	A	0.0000
116	T	A	0.2600
117	F	A	0.2961
118	W	A	0.2980
119	G	A	-0.0290
120	Q	A	-0.8106
121	G	A	0.0000
122	T	A	-0.6356
123	Q	A	-1.2408
124	V	A	0.0000
125	T	A	-0.9604
126	V	A	0.0000
127	S	A	-1.2016
128	S	A	-0.8555