Project name: 7fefaac04f4308e

Status: done

Started: 2026-06-22 16:05:54
Settings
Chain sequence(s) B: MAFMDELMARLKALKAVLEKLEELLSPEQAAKAREKFAEIEAKVEEIMAS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:55)
Show buried residues

Minimal score value
-4.728
Maximal score value
1.4736
Average score
-1.6489
Total score value
-82.4451

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 1.1466
2 A B 0.6295
3 F B 1.4736
4 M B 0.2258
5 D B -1.4727
6 E B -1.7276
7 L B -1.1162
8 M B -1.6585
9 A B -1.8955
10 R B -2.5722
11 L B 0.0000
12 K B -2.0895
13 A B -0.8331
14 L B -0.0533
15 K B -1.4121
16 A B -0.7512
17 V B 0.3900
18 L B -0.8496
19 E B -2.1897
20 K B -1.9161
21 L B -0.6145
22 E B -2.1826
23 E B -1.8765
24 L B 0.2487
25 L B -0.3713
26 S B -1.0978
27 P B -1.8018
28 E B -3.0997
29 Q B -2.7921
30 A B 0.0000
31 A B -3.2803
32 K B -4.3220
33 A B -3.6803
34 R B -4.7097
35 E B -4.7280
36 K B -4.2175
37 F B 0.0000
38 A B -3.1782
39 E B -3.6896
40 I B -2.5312
41 E B -3.1143
42 A B -2.7522
43 K B -3.0174
44 V B 0.0000
45 E B -3.0821
46 E B -2.8270
47 I B -0.9098
48 M B -0.7261
49 A B -0.9033
50 S B -0.5167
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018