Project name: model1_denem1

Chain sequence(s)	A: VQIVYKGGGGSGGGGSVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSGGGGSGFLGGRMKQIEDKIEEILSKIYHIENEIARIKKLIGER
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:37)

• Minimal score value: -4.4052
• Maximal score value: 2.9212
• Average score: -0.6046
• Total score value: -68.9239

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	A	1.9299
2	Q	A	1.3344
3	I	A	2.9212
4	V	A	2.8099
5	Y	A	1.3869
6	K	A	-0.9790
7	G	A	-1.2374
8	G	A	-1.5683
9	G	A	-1.5097
10	G	A	-1.2745
11	S	A	-1.0789
12	G	A	-1.1327
13	G	A	-1.3290
14	G	A	-1.0277
15	G	A	-0.9172
16	S	A	0.1752
17	V	A	0.6366
18	I	A	0.8747
19	C	A	0.0000
20	D	A	-1.8060
21	G	A	-1.0022
22	C	A	-0.1645
23	N	A	-1.2885
24	G	A	-0.2010
25	P	A	0.4846
26	V	A	1.2273
27	V	A	2.0681
28	G	A	0.7197
29	T	A	0.4412
30	R	A	0.3516
31	Y	A	0.0411
32	K	A	-0.0719
33	C	A	0.0000
34	S	A	0.4501
35	V	A	1.2999
36	C	A	0.3850
37	P	A	-0.3687
38	D	A	-1.4774
39	Y	A	-0.5953
40	D	A	0.0000
41	L	A	0.0000
42	C	A	0.0000
43	S	A	0.3774
44	V	A	1.2256
45	C	A	0.0000
46	E	A	-1.1197
47	G	A	-0.8979
48	K	A	-1.8360
49	G	A	-1.4347
50	L	A	-1.1131
51	H	A	-1.5968
52	R	A	-2.5622
53	G	A	-1.5017
54	H	A	-0.9784
55	T	A	-0.5029
56	K	A	-0.3725
57	L	A	0.4961
58	A	A	0.4877
59	F	A	0.6507
60	P	A	0.3733
61	S	A	0.4116
62	P	A	0.3840
63	F	A	1.6069
64	G	A	0.0538
65	H	A	-0.6009
66	L	A	0.5620
67	S	A	-0.4993
68	E	A	-1.5631
69	G	A	-0.5242
70	F	A	0.9748
71	S	A	0.0273
72	G	A	-0.6155
73	G	A	-1.1340
74	G	A	-1.1151
75	G	A	-0.9034
76	S	A	-0.2636
77	G	A	0.0217
78	F	A	1.4581
79	L	A	0.3557
80	G	A	-0.6958
81	G	A	-1.5037
82	R	A	-2.5024
83	M	A	-1.8724
84	K	A	-3.5553
85	Q	A	-3.5121
86	I	A	-2.5444
87	E	A	-3.8703
88	D	A	-4.4052
89	K	A	-3.0723
90	I	A	-1.6869
91	E	A	-2.9721
92	E	A	-2.7842
93	I	A	-0.2357
94	L	A	0.1819
95	S	A	-0.6506
96	K	A	-1.0002
97	I	A	0.3757
98	Y	A	0.5752
99	H	A	-0.8327
100	I	A	-0.1007
101	E	A	-1.6488
102	N	A	-2.4752
103	E	A	-2.2574
104	I	A	-0.8171
105	A	A	-1.9677
106	R	A	-2.2248
107	I	A	-0.1971
108	K	A	-1.6707
109	K	A	-2.1978
110	L	A	0.1571
111	I	A	0.4132
112	G	A	-1.5446
113	E	A	-2.4831
114	R	A	-2.1849