Project name: dag10

Chain sequence(s)	A: YAEGTFTSDYSIALDKIAQQEFVQWLLAGGPSSGAPPPS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)

• Minimal score value: -2.2005
• Maximal score value: 1.7411
• Average score: -0.2163
• Total score value: -8.4369

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Y	A	0.8766
2	A	A	0.0796
3	E	A	-1.2234
4	G	A	-0.5786
5	T	A	-0.0435
6	F	A	1.1011
7	T	A	0.2298
8	S	A	0.0330
9	D	A	-0.4581
10	Y	A	1.0049
11	S	A	0.5450
12	I	A	0.6271
13	A	A	0.2068
14	L	A	0.3937
15	D	A	-1.7753
16	K	A	-1.6870
17	I	A	0.0182
18	A	A	-1.1548
19	Q	A	-2.2005
20	Q	A	-2.0468
21	E	A	-1.7827
22	F	A	-0.1200
23	V	A	0.3569
24	Q	A	-0.6728
25	W	A	0.1803
26	L	A	1.3985
27	L	A	1.7411
28	A	A	0.8060
29	G	A	0.2997
30	G	A	0.0000
31	P	A	-0.4748
32	S	A	-0.4997
33	S	A	-0.3114
34	G	A	-0.7828
35	A	A	-0.4312
36	P	A	-0.5109
37	P	A	-0.4131
38	P	A	-0.6198
39	S	A	-0.5480