Project name: obj1 [mutate: GR10C, WE47C]

Status: done

Started: 2025-02-10 09:03:10
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues GR10C,WE47C
Energy difference between WT (input) and mutated protein (by FoldX) 4.39177 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:35)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-3.3267
Maximal score value
1.5458
Average score
-0.7275
Total score value
-87.2981

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.0063
2 V C -0.9165
3 Q C -1.2443
4 L C 0.0000
5 V C 0.5648
6 E C 0.2380
7 S C -0.5586
8 G C -1.1502
9 G C -0.7504
10 R C -0.7587 mutated: GR10C
11 L C 0.5151
12 V C 0.0000
13 Q C -1.4608
14 P C -1.5540
15 G C -1.4201
16 G C -1.0106
17 S C -1.3167
18 L C 0.0000
19 R C -2.2057
20 L C 0.0000
21 S C -0.5255
22 C C 0.0000
23 A C -0.2017
24 A C 0.0000
25 S C -0.2017
26 D C 0.0000
27 F C 1.5458
28 T C 0.2525
29 F C 0.0000
30 R C -2.0328
31 S C -0.8867
32 Y C -1.2168
33 E C -1.1383
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.5672
40 A C -0.9791
41 P C -1.2942
42 G C -1.4405
43 K C -2.1323
44 G C -1.0612
45 L C -0.1194
46 E C -1.3907
47 E C -1.8420 mutated: WE47C
48 V C 0.0000
49 S C 0.0000
50 A C 0.1536
51 I C 0.0000
52 S C -0.5365
53 G C -1.2453
54 S C -1.2288
55 G C -1.0811
56 G C -0.7345
57 S C -0.2359
58 T C 0.3569
59 Y C 0.9421
60 Y C -0.4951
61 A C -1.5220
62 D C -2.2977
63 S C -1.7062
64 V C 0.0000
65 K C -2.3272
66 G C -1.6103
67 R C 0.0000
68 F C 0.0000
69 T C -0.6297
70 I C 0.0000
71 S C -0.5614
72 R C -1.3626
73 D C -1.9805
74 N C -2.1901
75 S C -1.7905
76 K C -2.3163
77 N C -1.6491
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6693
81 L C 0.0000
82 Q C -1.2795
83 M C 0.0000
84 N C -1.3503
85 S C -1.2309
86 L C 0.0000
87 R C -2.5038
88 A C -1.9388
89 E C -2.3504
90 D C 0.0000
91 T C -0.6337
92 A C 0.0000
93 I C 0.9156
94 Y C 0.0000
95 Y C 0.3964
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.1938
101 D C -3.3267
102 G C -2.0637
103 F C -1.1413
104 N C -2.4061
105 K C -3.1771
106 G C -1.9121
107 F C -1.0110
108 D C -1.1148
109 Y C -0.2195
110 W C 0.5501
111 G C -0.0702
112 Q C -0.8796
113 G C 0.1186
114 T C 0.3431
115 L C 1.3442
116 V C 0.0000
117 T C -0.1767
118 V C 0.0000
119 S C -0.8864
120 S C -1.1154
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018