Project name: query_structure

Status: done

Started: 2026-03-16 20:39:05
Settings
Chain sequence(s) A: MAAEMHSFCAFKADRGPCRADFHRFFFNIFTRQCEEFHYGGCGGNQNRFESLEECKKMCTRDSASSASGDFD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)
Show buried residues

Minimal score value
-3.2915
Maximal score value
1.3001
Average score
-1.2986
Total score value
-93.4999

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7356
2 A A 0.0234
3 A A -1.0657
4 E A -1.6795
5 M A -0.9281
6 H A -0.5953
7 S A -0.1245
8 F A 0.3507
9 C A 0.0000
10 A A 0.3474
11 F A -0.1292
12 K A -1.7927
13 A A -2.3050
14 D A -2.6761
15 R A -3.2582
16 G A -1.7814
17 P A -1.0136
18 C A -1.1024
19 R A -2.2809
20 A A -1.7712
21 D A -2.3905
22 F A -1.1291
23 H A -2.0539
24 R A -2.3190
25 F A -2.0575
26 F A -1.5926
27 F A 0.0000
28 N A -0.8255
29 I A 0.1400
30 F A 1.3001
31 T A -0.3986
32 R A -1.8797
33 Q A -2.1576
34 C A 0.0000
35 E A -2.0176
36 E A -2.7984
37 F A 0.0000
38 H A -2.7415
39 Y A 0.0000
40 G A 0.0000
41 G A -0.9188
42 C A -0.0997
43 G A -0.8718
44 G A -1.8749
45 N A -1.7733
46 Q A -1.6026
47 N A 0.0000
48 R A -2.2415
49 F A -1.9857
50 E A -2.4282
51 S A -2.2481
52 L A -1.9983
53 E A -2.8915
54 E A -2.6207
55 C A 0.0000
56 K A -3.2915
57 K A -3.2567
58 M A -1.6589
59 C A 0.0000
60 T A -2.7029
61 R A -2.9389
62 D A -2.8095
63 S A -1.4550
64 A A -0.8974
65 S A -1.0009
66 S A -0.5662
67 A A -0.5471
68 S A -0.6328
69 G A -1.2418
70 D A -1.6501
71 F A 0.1315
72 D A -1.4585
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018