Project name: 80689794cbf4674

Status: done

Started: 2026-07-01 15:23:53
Settings
Chain sequence(s) B: SLTSQVSWSITLTEEKEVLTLIATSTRESFKNREEAEKVALSDPVTVVSA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)
Show buried residues

Minimal score value
-4.1415
Maximal score value
1.9191
Average score
-0.6654
Total score value
-33.2676

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B 0.4974
2 L B 1.3578
3 T B 0.2497
4 S B -0.0905
5 Q B -0.4106
6 V B 1.2986
7 S B 0.6814
8 W B 1.0377
9 S B 0.4842
10 I B 1.0510
11 T B 0.2709
12 L B -0.0340
13 T B -1.3541
14 E B -2.8497
15 E B -3.1680
16 K B -2.2871
17 E B -0.9486
18 V B 1.6795
19 L B 1.8864
20 T B 1.3033
21 L B 0.8866
22 I B 0.0178
23 A B 0.5621
24 T B -0.4128
25 S B -0.6043
26 T B -1.3974
27 R B -2.7743
28 E B -2.9014
29 S B -1.7581
30 F B -2.1815
31 K B -2.6953
32 N B -3.0861
33 R B -3.9740
34 E B -4.1415
35 E B -3.2041
36 A B 0.0000
37 E B -3.4998
38 K B -2.9073
39 V B -1.0404
40 A B -1.1729
41 L B 0.4345
42 S B -0.5102
43 D B -1.6566
44 P B -0.6671
45 V B 0.6388
46 T B 1.2614
47 V B 1.9191
48 V B 1.7940
49 S B -0.3290
50 A B -0.5231
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018