Project name: query_structure

Status: done

Started: 2026-03-16 23:51:55
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSGSHMRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVWRVGGYRHRALVLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)
Show buried residues

Minimal score value
-3.4415
Maximal score value
1.9541
Average score
-0.8358
Total score value
-86.0834

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.6766
2 Q A -1.0106
3 V A -1.2679
4 D A -1.2764
5 I A 0.0000
6 V A 1.2931
7 P A 0.2868
8 S A -0.5670
9 Q A -1.8768
10 G A 0.0000
11 E A -2.9100
12 I A 0.0000
13 S A -1.1460
14 V A -0.1841
15 G A -1.2408
16 E A -2.2015
17 S A -0.9836
18 K A -0.5003
19 F A 1.9541
20 F A 0.0000
21 L A 0.9681
22 C A 0.0000
23 Q A -1.4238
24 V A 0.0000
25 A A -0.5149
26 G A -0.4956
27 S A -0.7492
28 G A -1.2179
29 S A -1.3892
30 H A -1.9068
31 M A -1.6305
32 R A -1.8851
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.4331
37 S A -1.3716
38 P A -1.2859
39 N A -2.0760
40 G A -2.2436
41 E A -3.2472
42 K A -2.8211
43 L A -1.6058
44 T A -1.0811
45 P A -0.9904
46 N A -1.9987
47 Q A -2.0824
48 Q A -2.1040
49 R A -1.4227
50 I A 0.0000
51 S A -0.2134
52 V A 0.0000
53 V A 0.6925
54 W A -0.6498
55 N A -1.9496
56 D A -3.1839
57 D A -3.4415
58 S A -2.3071
59 S A 0.0000
60 S A 0.0000
61 T A 0.7208
62 L A 0.0000
63 T A 0.8889
64 I A 0.0000
65 Y A -0.4431
66 N A -1.8449
67 A A 0.0000
68 N A -0.9527
69 I A -0.1308
70 D A -1.6157
71 D A 0.0000
72 A A -0.9579
73 G A -0.4780
74 I A 0.2635
75 Y A 0.0000
76 K A -1.2210
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 W A -0.5780
81 R A -1.2872
82 V A -0.8200
83 G A -1.4466
84 G A -1.1624
85 Y A -0.3102
86 R A -2.3930
87 H A -2.2822
88 R A -2.5801
89 A A -1.0987
90 L A 0.1811
91 V A 0.6012
92 L A 0.4569
93 G A -0.5383
94 E A -1.8664
95 A A -1.4563
96 T A -0.7109
97 V A 0.0000
98 N A -1.6111
99 V A 0.0000
100 K A -2.4736
101 I A 0.0000
102 F A -0.4533
103 Q A -0.4677
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018