Project name: 8117e051b26d6a1

Chain sequence(s)	A: NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)

• Minimal score value: -2.8057
• Maximal score value: 1.6083
• Average score: -0.7479
• Total score value: -80.7681

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.5599
2	F	A	0.0000
3	M	A	0.2192
4	L	A	0.0000
5	N	A	-1.2129
6	Q	A	0.0000
7	P	A	-1.1879
8	H	A	-1.7627
9	S	A	-1.2104
11	V	A	-0.7968
12	S	A	-0.6153
13	E	A	-0.9904
14	S	A	-0.7717
15	P	A	-1.4059
16	G	A	-1.6070
17	K	A	-1.9458
18	T	A	-1.1781
19	V	A	0.0000
20	T	A	-0.1549
21	I	A	0.0000
22	S	A	-0.4673
23	C	A	0.0000
24	T	A	-0.7069
25	R	A	0.0000
26	S	A	-0.7537
27	S	A	-0.8986
28	G	A	-1.5701
29	N	A	-2.1288
30	I	A	0.0000
35	A	A	-0.9759
36	S	A	-0.7512
37	N	A	-0.2980
38	Y	A	0.4666
39	V	A	0.0000
40	Q	A	0.0000
41	W	A	0.0000
42	Y	A	0.4824
43	Q	A	-0.6223
44	Q	A	-1.3341
45	S	A	-0.2753
49	A	A	-0.0501
50	P	A	0.0338
51	I	A	1.0836
52	T	A	0.4866
53	V	A	0.0000
54	I	A	0.0000
55	Y	A	-0.9707
56	E	A	-1.8630
57	D	A	-1.5171
65	N	A	-2.1915
66	Q	A	-2.1751
67	R	A	-1.9788
68	P	A	-0.8106
69	S	A	-0.6618
70	G	A	-0.8423
71	V	A	-0.8803
72	P	A	-1.2351
74	D	A	-2.1441
75	R	A	-1.4531
76	F	A	0.0000
77	A	A	-1.1553
78	G	A	-1.1592
79	S	A	-1.2010
80	I	A	-0.9238
81	D	A	-2.0355
82	R	A	-2.8057
83	S	A	-1.6961
84	S	A	-1.3844
85	N	A	-1.8174
86	S	A	0.0000
87	A	A	0.0000
88	S	A	-0.4568
89	L	A	0.0000
90	T	A	-0.2095
91	I	A	0.0000
92	S	A	-1.1674
93	G	A	-1.4318
94	L	A	0.0000
95	K	A	-2.4189
96	T	A	-1.9226
97	E	A	-2.6885
98	D	A	0.0000
99	E	A	-2.5797
100	A	A	-1.9112
101	D	A	-1.7991
102	Y	A	0.0000
103	Y	A	-0.1455
104	C	A	0.0000
105	Q	A	0.0000
106	S	A	0.0000
107	Y	A	0.1950
108	D	A	-1.3982
109	A	A	-1.3387
114	R	A	-2.0885
115	N	A	-1.4005
116	V	A	1.0377
117	V	A	0.0000
118	F	A	1.6083
119	G	A	0.0000
120	G	A	-0.6008
121	G	A	0.0000
122	T	A	0.0000
123	R	A	-2.1840
124	L	A	0.0000
125	T	A	-0.7960
126	V	A	0.0000
127	L	A	0.3364
128	G	A	-0.0461