Project name: Nanoluc

Status: done

Started: 2026-07-15 15:59:11
Settings
Chain sequence(s) A: MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:10)
Show buried residues

Minimal score value
-2.8474
Maximal score value
1.657
Average score
-0.6085
Total score value
-104.048

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.6570
2 V A 1.5987
3 F A 0.2564
4 T A -0.7517
5 L A 0.0000
6 E A -1.8915
7 D A -1.2435
8 F A 0.0000
9 V A -0.4289
10 G A -0.5066
11 D A -0.8435
12 W A 0.0000
13 R A -1.9851
14 Q A -1.0889
15 T A -0.7878
16 A A -0.0813
17 G A 0.5518
18 Y A 0.8543
19 N A -0.1846
20 L A -0.8320
21 D A -2.6100
22 Q A -2.3908
23 V A 0.0000
24 L A -1.8369
25 E A -2.8474
26 Q A -2.3481
27 G A -1.6813
28 G A -1.0502
29 V A -0.8045
30 S A -0.6317
31 S A -1.0124
32 L A -0.4457
33 F A 0.0000
34 Q A -1.4438
35 N A -1.2569
36 L A -0.2987
37 G A -0.1219
38 V A 0.0397
39 S A -0.1451
40 V A 0.3987
41 T A 0.0509
42 P A 0.0000
43 I A -0.6366
44 Q A 0.0000
45 R A -1.2545
46 I A 0.0000
47 V A 0.2614
48 L A -0.2066
49 S A -0.5894
50 G A -1.4675
51 E A -2.3961
52 N A -2.2480
53 G A 0.0000
54 L A 0.0000
55 K A -0.6186
56 I A 0.0000
57 D A 0.0000
58 I A 0.0000
59 H A -0.1717
60 V A 0.0000
61 I A 1.2910
62 I A 0.0000
63 P A -0.9195
64 Y A -1.2196
65 E A -1.9904
66 G A -1.2395
67 L A -0.9635
68 S A -1.3150
69 G A -1.4979
70 D A -2.4323
71 Q A -1.7884
72 M A -1.4459
73 G A -2.0894
74 Q A -2.0288
75 I A 0.0000
76 E A -2.3595
77 K A -2.4233
78 I A -0.9279
79 F A -0.7657
80 K A -1.7621
81 V A 0.2152
82 V A 0.6697
83 Y A 1.2658
84 P A 0.1514
85 V A 0.3529
86 D A -1.9444
87 D A -2.6346
88 H A -2.2993
89 H A -1.1338
90 F A 0.0000
91 K A 0.7190
92 V A 0.0000
93 I A 0.3512
94 L A 0.0000
95 H A -1.2212
96 Y A 0.0000
97 G A -0.9648
98 T A -0.4108
99 L A 0.0000
100 V A 0.7199
101 I A 0.0000
102 D A -0.9122
103 G A 0.5818
104 V A 1.5079
105 T A 0.0000
106 P A -0.7509
107 N A -2.0246
108 M A 0.0000
109 I A -1.2097
110 D A -0.5028
111 Y A -0.1318
112 F A -0.1270
113 G A -1.0227
114 R A -1.5152
115 P A -1.5737
116 Y A 0.0000
117 E A -1.6537
118 G A 0.0000
119 I A 1.5134
120 A A 0.0000
121 V A 0.4747
122 F A -0.8287
123 D A -1.8063
124 G A -0.5477
125 K A -1.0895
126 K A -0.9205
127 I A 0.0000
128 T A -0.0975
129 V A 0.0000
130 T A 0.3286
131 G A -0.4873
132 T A -1.2947
133 L A 0.0000
134 W A -0.6962
135 N A -1.1041
136 G A -1.3189
137 N A -1.9606
138 K A -2.3424
139 I A 0.0000
140 I A 0.0560
141 D A 0.0000
142 E A -0.1222
143 R A 0.0000
144 L A -0.2998
145 I A -0.4305
146 N A -0.8734
147 P A -1.0978
148 D A -2.3178
149 G A -1.7814
150 S A -1.5879
151 L A 0.0000
152 L A -0.0923
153 F A 0.0000
154 R A -0.4263
155 V A -0.0145
156 T A -0.6518
157 I A 0.0000
158 N A -2.0607
159 G A -1.1533
160 V A -0.7619
161 T A -0.1995
162 G A 0.0000
163 W A 0.3337
164 R A 0.0000
165 L A -0.1426
166 C A 0.0000
167 E A -2.4224
168 R A -1.3488
169 I A 0.1326
170 L A 1.4053
171 A A 0.8340
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018