Project name: obj1 [mutate: QH3C, QG13C, GM10C, RY19C, SV25C, MC34C, PR41C, WA47C, GV53C, RP67C, KS65C, QI82C, RH87C, YQ95C, LE99C, WN110C, VD118C, SR120C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	QI82C,WA47C,GV53C,PR41C,YQ95C,SV25C,RP67C,LE99C,KS65C,QG13C,RY19C,RH87C,VD118C,QH3C,MC34C,SR120C,GM10C,WN110C
Energy difference between WT (input) and mutated protein (by FoldX)	34.3545 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:04:28)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:50)

• Minimal score value: -3.2333
• Maximal score value: 2.2068
• Average score: -0.4773
• Total score value: -57.2814

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-1.8042
2	V	C	0.0000
3	H	C	-0.7093	mutated: QH3C
4	L	C	0.0000
5	V	C	1.1376
6	E	C	0.2595
7	S	C	0.3484
8	G	C	0.3693
9	G	C	1.3488
10	M	C	2.2068	mutated: GM10C
11	L	C	2.1876
12	V	C	0.4341
13	G	C	-0.8818	mutated: QG13C
14	P	C	-1.4812
15	G	C	-1.1973
16	G	C	-0.7670
17	S	C	-0.3705
18	L	C	0.0000
19	Y	C	1.3308	mutated: RY19C
20	L	C	0.0000
21	S	C	0.4697
22	C	C	0.0000
23	A	C	0.5070
24	A	C	0.0000
25	V	C	1.8598	mutated: SV25C
26	D	C	0.0000
27	F	C	1.9986
28	T	C	0.5576
29	F	C	0.0000
30	R	C	-1.7890
31	S	C	-0.6503
32	Y	C	-0.9568
33	E	C	-0.7818
34	C	C	0.0000	mutated: MC34C
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.9980
40	A	C	-1.8783
41	R	C	-2.9436	mutated: PR41C
42	G	C	-2.2264
43	K	C	-2.6553
44	G	C	-1.3027
45	L	C	0.2953
46	E	C	-0.5629
47	A	C	-0.0072	mutated: WA47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.5529
51	I	C	0.0000
52	S	C	-0.1946
53	V	C	-0.5847	mutated: GV53C
54	S	C	-0.9069
55	G	C	-0.8771
56	G	C	-0.6166
57	S	C	-0.1145
58	T	C	0.4644
59	Y	C	1.3512
60	Y	C	0.5258
61	A	C	-0.5953
62	D	C	-1.7460
63	S	C	-1.3382
64	V	C	0.0000
65	S	C	-0.7630	mutated: KS65C
66	G	C	-0.8998
67	P	C	-0.5431	mutated: RP67C
68	F	C	0.0000
69	T	C	0.3083
70	I	C	0.0000
71	S	C	-0.3492
72	R	C	-1.2015
73	D	C	-1.8634
74	N	C	-2.0811
75	S	C	-1.7832
76	K	C	-2.3094
77	N	C	-1.2289
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	0.3857
81	L	C	0.0000
82	I	C	0.8574	mutated: QI82C
83	M	C	0.0000
84	N	C	-0.8082
85	S	C	-1.1974
86	L	C	0.0000
87	H	C	-2.4015	mutated: RH87C
88	A	C	-2.2454
89	E	C	-2.7347
90	D	C	-1.4664
91	T	C	0.0000
92	A	C	0.0000
93	I	C	0.7360
94	Y	C	0.0000
95	Q	C	-0.1659	mutated: YQ95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	E	C	0.0000	mutated: LE99C
100	R	C	-2.9858
101	D	C	-3.2333
102	G	C	-1.9942
103	F	C	-1.0966
104	N	C	-2.3704
105	K	C	-3.0969
106	G	C	-1.7108
107	F	C	-0.7990
108	D	C	-1.2967
109	Y	C	-1.0048
110	N	C	-1.2999	mutated: WN110C
111	G	C	0.0000
112	Q	C	-1.2458
113	G	C	-0.2829
114	T	C	0.8028
115	L	C	2.0545
116	V	C	0.0000
117	T	C	0.6198
118	D	C	0.0000	mutated: VD118C
119	S	C	-1.3432
120	R	C	-2.5112	mutated: SR120C