Project name: lanm_A6

Chain sequence(s)	A: APTTTTKVDIAAFNPDKDGTIELKEALAAASAAFDKLDPDKDGTLEAKELKGRVSEADLKKADPDNDGTLEKKEYLAAVEAQFKAANPDNDGTIEARELASPAGSALVNLIR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.1858
• Maximal score value: 0.0
• Average score: -1.5591
• Total score value: -174.6184

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.1006
2	P	A	-0.2998
3	T	A	-0.2344
4	T	A	-0.4993
5	T	A	-0.8367
6	T	A	-1.2139
7	K	A	-2.1317
8	V	A	-1.6249
9	D	A	-2.0475
10	I	A	-1.5245
11	A	A	-1.7154
12	A	A	-1.0351
13	F	A	0.0000
14	N	A	0.0000
15	P	A	-1.9194
16	D	A	-3.3219
17	K	A	-3.5415
18	D	A	-3.4692
19	G	A	-2.3102
20	T	A	-1.9775
21	I	A	0.0000
22	E	A	-1.4285
23	L	A	-0.9934
24	K	A	-1.6252
25	E	A	0.0000
26	A	A	0.0000
27	L	A	-0.2059
28	A	A	-0.1798
29	A	A	-0.3047
30	A	A	0.0000
31	S	A	-0.6898
32	A	A	-0.9171
33	A	A	0.0000
34	F	A	0.0000
35	D	A	-3.0379
36	K	A	-3.0373
37	L	A	0.0000
38	D	A	0.0000
39	P	A	-2.7325
40	D	A	-3.6891
41	K	A	-4.1083
42	D	A	-3.6206
43	G	A	-2.9030
44	T	A	-2.5540
45	L	A	0.0000
46	E	A	-1.8473
47	A	A	-2.2981
48	K	A	-2.7245
49	E	A	-2.1089
50	L	A	0.0000
51	K	A	-3.0886
52	G	A	-2.0796
53	R	A	-2.2155
54	V	A	-1.7061
55	S	A	-2.2911
56	E	A	-3.2142
57	A	A	-2.4805
58	D	A	-3.0809
59	L	A	-2.9130
60	K	A	-4.1858
61	K	A	-3.6963
62	A	A	-2.6899
63	D	A	0.0000
64	P	A	-2.6107
65	D	A	-3.5592
66	N	A	-3.8266
67	D	A	-3.5990
68	G	A	-2.6104
69	T	A	-2.3381
70	L	A	0.0000
71	E	A	-2.7554
72	K	A	-2.3380
73	K	A	-2.4437
74	E	A	-2.0291
75	Y	A	0.0000
76	L	A	-0.7454
77	A	A	-0.7448
78	A	A	-0.8765
79	V	A	0.0000
80	E	A	-1.0462
81	A	A	-0.8376
82	Q	A	-0.8426
83	F	A	0.0000
84	K	A	-2.6052
85	A	A	-1.4044
86	A	A	0.0000
87	N	A	0.0000
88	P	A	-2.2147
89	D	A	-3.3740
90	N	A	-3.5574
91	D	A	-3.5105
92	G	A	-2.5104
93	T	A	-2.0579
94	I	A	0.0000
95	E	A	-2.2890
96	A	A	-1.8971
97	R	A	-2.2835
98	E	A	-1.7592
99	L	A	0.0000
100	A	A	-1.1550
101	S	A	-0.6358
102	P	A	-0.3028
103	A	A	-0.4946
104	G	A	0.0000
105	S	A	-0.2559
106	A	A	-0.4830
107	L	A	0.0000
108	V	A	0.0000
109	N	A	-1.2204
110	L	A	-0.7678
111	I	A	0.0000
112	R	A	-2.1856