Project name: EPKSSDKTHTPPRT-141VHH

Chain sequence(s)	A: EPKSSDKTHTPPRTEVQLVESGGGLVQPGGSLRLSCAASLEHVAIGWFRQAPGKEREGVSCISSSGGHIHYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAAAVSYWECYDKLDYWGQGTLVTVSSPP
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)

• Minimal score value: -2.3399
• Maximal score value: 1.7626
• Average score: -0.4029
• Total score value: -54.3925

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.8786
2	P	A	-0.9852
3	K	A	-1.7860
4	S	A	-0.5670
5	S	A	-0.5849
6	D	A	-2.1423
7	K	A	-2.0430
8	T	A	-0.5697
9	H	A	-1.0164
10	T	A	-0.3027
11	P	A	-0.3140
12	P	A	-0.6360
13	R	A	-1.9033
14	T	A	-0.7444
15	E	A	-1.7838
16	V	A	-0.2179
17	Q	A	-0.7870
18	L	A	0.0000
19	V	A	1.7393
20	E	A	0.1169
21	S	A	-0.2386
22	G	A	-0.3676
23	G	A	-0.2715
24	G	A	0.0710
25	L	A	1.5504
26	V	A	0.2708
27	Q	A	-1.1890
28	P	A	-0.4638
29	G	A	-0.5274
30	G	A	-0.1727
31	S	A	-0.2326
32	L	A	-0.1189
33	R	A	-1.8831
34	L	A	0.0000
35	S	A	-0.0202
36	C	A	0.0000
37	A	A	0.0301
38	A	A	-0.0154
39	S	A	-0.0791
40	L	A	0.0397
41	E	A	-1.9245
42	H	A	-1.3209
43	V	A	0.0000
44	A	A	0.0000
45	I	A	0.0000
46	G	A	0.0000
47	W	A	0.0000
48	F	A	0.2202
49	R	A	0.0000
50	Q	A	-0.5867
51	A	A	-0.1201
52	P	A	-0.3376
53	G	A	-0.8147
54	K	A	-2.1211
55	E	A	-2.3399
56	R	A	-1.6340
57	E	A	-0.9526
58	G	A	-0.1971
59	V	A	0.0000
60	S	A	0.0000
61	C	A	0.0000
62	I	A	0.0000
63	S	A	0.0000
64	S	A	-0.1851
65	S	A	-0.2475
66	G	A	-0.2721
67	G	A	-0.6718
68	H	A	-0.9027
69	I	A	0.5783
70	H	A	-0.7667
71	Y	A	0.0976
72	A	A	-0.2629
73	D	A	-1.8179
74	S	A	-0.4908
75	V	A	0.0000
76	K	A	-1.7846
77	G	A	-0.8352
78	R	A	-0.4238
79	F	A	0.0000
80	T	A	-0.1163
81	I	A	0.0000
82	S	A	-0.1649
83	R	A	-0.4049
84	D	A	-0.7980
85	N	A	-1.4562
86	S	A	-0.7455
87	K	A	-1.8146
88	N	A	-0.8864
89	T	A	0.0000
90	V	A	0.0000
91	Y	A	0.1437
92	L	A	0.0000
93	Q	A	-0.8895
94	M	A	0.0000
95	N	A	-1.1903
96	S	A	-0.4053
97	L	A	0.0000
98	R	A	-1.8334
99	A	A	-0.6030
100	E	A	-1.8095
101	D	A	0.0000
102	T	A	-0.0166
103	A	A	0.0000
104	V	A	0.7383
105	Y	A	0.0000
106	Y	A	0.1433
107	C	A	0.0000
108	A	A	0.0000
109	A	A	0.0000
110	A	A	0.0000
111	V	A	1.7626
112	S	A	0.4533
113	Y	A	1.2680
114	W	A	1.1573
115	E	A	-1.0089
116	C	A	0.0000
117	Y	A	0.3822
118	D	A	-1.9685
119	K	A	-1.9882
120	L	A	-0.4616
121	D	A	-1.6902
122	Y	A	0.1356
123	W	A	0.5511
124	G	A	-0.1858
125	Q	A	-1.2269
126	G	A	-0.2931
127	T	A	0.2557
128	L	A	1.6193
129	V	A	0.0000
130	T	A	0.1605
131	V	A	0.0000
132	S	A	-0.1474
133	S	A	-0.2792
134	P	A	-0.3399
135	P	A	-0.3012