Project name: 81d89fdbd410950

Status: done

Started: 2026-07-01 15:24:17
Settings
Chain sequence(s) B: GQLTVNSISVEDFPDGTGVLTVTLTLSQEQPVTLWWEDLETGERRRAGTI
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)
Show buried residues

Minimal score value
-4.4049
Maximal score value
2.4084
Average score
-0.8288
Total score value
-41.4395

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -1.7283
2 Q B -1.3965
3 L B -0.0173
4 T B 0.1914
5 V B 1.0098
6 N B -0.2277
7 S B 0.5787
8 I B 2.4084
9 S B 1.5931
10 V B 1.2644
11 E B -1.2916
12 D B -2.1486
13 F B -1.3640
14 P B -1.3880
15 D B -2.2340
16 G B -1.6779
17 T B -1.3344
18 G B -0.9639
19 V B 0.7704
20 L B 1.4309
21 T B 1.3998
22 V B 1.6788
23 T B 0.5525
24 L B 0.8133
25 T B 0.0622
26 L B -0.3175
27 S B -1.4343
28 Q B -2.6249
29 E B -2.6952
30 Q B -2.3277
31 P B -0.6106
32 V B 0.4017
33 T B 0.3876
34 L B 0.2574
35 W B -0.8917
36 W B -1.6200
37 E B -3.6367
38 D B -2.9455
39 L B -0.9215
40 E B -1.9681
41 T B -1.9438
42 G B -2.4385
43 E B -3.8265
44 R B -4.4049
45 R B -4.1480
46 R B -2.8596
47 A B -1.0202
48 G B -0.1162
49 T B 0.6613
50 I B 1.6224
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018