Project name: 81e9bb4db318310

Chain sequence(s)	A: EVQLLESGGGLVQPGGSLRLSCAASGFTFSKQYMSWVRQAPGKGIEWLSTISARGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDLKFLWAPTGGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)

• Minimal score value: -2.6365
• Maximal score value: 0.9973
• Average score: -0.7352
• Total score value: -86.7575

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9678
2	V	A	-1.1219
3	Q	A	-1.1883
4	L	A	0.0000
5	L	A	0.7874
6	E	A	-0.1113
7	S	A	-0.7440
8	G	A	-1.2493
9	G	A	-0.8644
10	G	A	-0.1040
11	L	A	0.9428
12	V	A	0.0000
13	Q	A	-1.3772
14	P	A	-1.4966
15	G	A	-1.3305
16	G	A	-0.9434
17	S	A	-1.3205
18	L	A	-1.0211
19	R	A	-2.2633
20	L	A	0.0000
21	S	A	-0.4965
22	C	A	0.0000
23	A	A	-0.1962
24	A	A	0.0000
25	S	A	-0.7426
26	G	A	-1.1227
27	F	A	-0.7311
28	T	A	-0.6888
29	F	A	0.0000
30	S	A	-1.7361
31	K	A	-1.9739
32	Q	A	-1.0445
33	Y	A	0.2354
34	M	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-1.0013
40	A	A	-1.3819
41	P	A	-1.1023
42	G	A	-1.5309
43	K	A	-2.3003
44	G	A	-1.2286
45	I	A	-0.1901
46	E	A	-0.3969
47	W	A	0.4047
48	L	A	0.0000
49	S	A	0.0000
50	T	A	0.1938
51	I	A	0.0000
52	S	A	-0.7343
53	A	A	-1.4086
54	R	A	-2.4600
55	G	A	-1.4027
56	G	A	-1.2670
57	S	A	-0.7448
58	T	A	-0.2087
59	S	A	-0.5633
60	Y	A	-0.9135
61	A	A	-1.3012
62	D	A	-2.4913
63	S	A	-1.6812
64	V	A	0.0000
65	K	A	-2.6365
66	G	A	-1.7665
67	R	A	-1.5919
68	F	A	0.0000
69	T	A	-0.9715
70	I	A	0.0000
71	S	A	-0.5066
72	R	A	-1.1820
73	D	A	-1.6515
74	N	A	-2.0905
75	S	A	-1.5399
76	K	A	-2.3193
77	N	A	-1.6746
78	T	A	-0.9785
79	L	A	0.0000
80	Y	A	-0.6508
81	L	A	0.0000
82	Q	A	-1.5513
83	M	A	0.0000
84	N	A	-1.4666
85	S	A	-1.1940
86	L	A	0.0000
87	R	A	-2.0721
88	A	A	-1.6143
89	E	A	-2.1605
90	D	A	0.0000
91	T	A	-0.8319
92	A	A	0.0000
93	V	A	-0.3144
94	Y	A	0.0000
95	Y	A	-0.0850
96	C	A	0.0000
97	A	A	0.0000
98	K	A	-0.8822
99	D	A	-1.0500
100	L	A	0.2833
101	K	A	-1.1133
102	F	A	0.0000
103	L	A	0.5627
104	W	A	0.9973
105	A	A	0.3160
106	P	A	-0.3206
107	T	A	-0.6996
108	G	A	-0.6494
109	G	A	-0.5371
110	Q	A	-1.1468
111	G	A	-0.6851
112	T	A	-0.7897
113	Q	A	-1.1578
114	V	A	0.0000
115	T	A	-0.3012
116	V	A	0.0000
117	S	A	-0.6533
118	S	A	-0.4997