Project name: 8256f2aebf7a994

Chain sequence(s)	A: AEFAAYKAALAAVKEAAKKYMAAVKKDLGDSPEVKELLALQKKLDATTAKMVAALEAKKWDEAVALAKEVQELVKKQVALADKIVGSLSDEAKAAYAALKAARAATEAALAALLKAIAAQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:00)

• Minimal score value: -3.8809
• Maximal score value: 0.0
• Average score: -1.3812
• Total score value: -165.7381

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.3654
2	E	A	-1.0135
3	F	A	-0.4897
4	A	A	-0.3337
5	A	A	-0.3686
6	Y	A	0.0000
7	K	A	-0.7689
8	A	A	-0.3115
9	A	A	-0.5376
10	L	A	-0.9471
11	A	A	-0.9633
12	A	A	-1.1966
13	V	A	0.0000
14	K	A	-2.9363
15	E	A	-3.4201
16	A	A	-2.6156
17	A	A	0.0000
18	K	A	-3.5058
19	K	A	-3.2047
20	Y	A	0.0000
21	M	A	0.0000
22	A	A	-1.8643
23	A	A	0.0000
24	V	A	0.0000
25	K	A	-2.7561
26	K	A	-2.9409
27	D	A	-2.3643
28	L	A	-1.5948
29	G	A	-2.3262
30	D	A	-3.0309
31	S	A	-2.0424
32	P	A	-1.9342
33	E	A	-2.2782
34	V	A	0.0000
35	K	A	-3.1151
36	E	A	-2.9895
37	L	A	0.0000
38	L	A	-1.8477
39	A	A	-1.9401
40	L	A	-1.8007
41	Q	A	-2.1100
42	K	A	-2.8933
43	K	A	-2.7604
44	L	A	0.0000
45	D	A	-2.4390
46	A	A	-1.8091
47	T	A	0.0000
48	T	A	0.0000
49	A	A	-1.0451
50	K	A	-2.0549
51	M	A	0.0000
52	V	A	-1.0609
53	A	A	-1.6223
54	A	A	0.0000
55	L	A	0.0000
56	E	A	-2.5101
57	A	A	-2.1084
58	K	A	-3.1244
59	K	A	-3.0700
60	W	A	-2.1541
61	D	A	-2.7027
62	E	A	-3.0106
63	A	A	0.0000
64	V	A	-1.0040
65	A	A	-1.4389
66	L	A	-1.9345
67	A	A	0.0000
68	K	A	-2.9035
69	E	A	-3.3590
70	V	A	0.0000
71	Q	A	-3.4622
72	E	A	-3.8809
73	L	A	0.0000
74	V	A	-1.9550
75	K	A	-2.7294
76	K	A	-1.9179
77	Q	A	0.0000
78	V	A	-0.9743
79	A	A	-1.2831
80	L	A	-1.4932
81	A	A	0.0000
82	D	A	-2.2709
83	K	A	-2.4478
84	I	A	0.0000
85	V	A	-1.3838
86	G	A	-1.3390
87	S	A	-0.9643
88	L	A	0.0000
89	S	A	-2.2813
90	D	A	-3.1332
91	E	A	-3.3283
92	A	A	0.0000
93	K	A	-2.3130
94	A	A	-1.7435
95	A	A	-1.8478
96	Y	A	0.0000
97	A	A	-0.9397
98	A	A	-0.7801
99	L	A	0.0000
100	K	A	-1.5188
101	A	A	-0.7295
102	A	A	-1.1421
103	R	A	-1.3142
104	A	A	-1.0422
105	A	A	-0.7070
106	T	A	0.0000
107	E	A	-1.8881
108	A	A	-0.7803
109	A	A	-0.9102
110	L	A	0.0000
111	A	A	-0.9234
112	A	A	-0.9022
113	L	A	0.0000
114	L	A	-0.5578
115	K	A	-1.7993
116	A	A	-1.1083
117	I	A	0.0000
118	A	A	-0.8714
119	A	A	-0.8864
120	Q	A	-1.2692