Project name: 8298a427da78b70

Status: done

Started: 2026-07-21 14:37:46
Settings
Chain sequence(s) A: MSSGNILWGSQNPIVFKNSFGVSNADTGSQDDLSQQNPFAEGYGVLLILLMVIQAIANNKFIEVQKNAERARNTQEKSNEMDEVIAKAAKGDAKTKEEVPEDVIKYMRDNGILIDGMTIDDYMAKYGDHGKLDKGGLQAIKAALDNDANRNTDLMSQGQITIQKMSQELNAVLTQLTGLISKWGEISSMIAQKTYS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-3.9622
Maximal score value
3.6798
Average score
-1.1245
Total score value
-220.4001

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8309
2 S A -0.1014
3 S A -0.6445
4 G A -0.6646
5 N A -0.6942
6 I A 0.8002
7 L A 1.4338
8 W A 0.6517
9 G A -0.2672
10 S A -1.1106
11 Q A -1.9744
12 N A -1.5804
13 P A -0.0085
14 I A 1.4878
15 V A 2.1279
16 F A 1.3676
17 K A -1.2296
18 N A -1.6714
19 S A -0.8651
20 F A 0.0786
21 G A 0.2691
22 V A 1.3705
23 S A -0.3956
24 N A -1.5458
25 A A -1.4810
26 D A -2.4399
27 T A -1.6898
28 G A -1.7276
29 S A -1.9555
30 Q A -3.0860
31 D A -3.4520
32 D A -3.0729
33 L A -0.7987
34 S A -1.4946
35 Q A -2.8252
36 Q A -2.3705
37 N A 0.0000
38 P A -1.0580
39 F A -0.2042
40 A A -0.8905
41 E A -1.6912
42 G A -0.1131
43 Y A 0.4904
44 G A 0.7901
45 V A 2.3550
46 L A 1.8944
47 L A 0.0000
48 I A 3.6798
49 L A 2.7493
50 L A 0.0000
51 M A 2.9625
52 V A 2.7035
53 I A 0.0000
54 Q A 1.0462
55 A A 0.8554
56 I A 1.5174
57 A A 0.0000
58 N A -0.0797
59 N A -0.5332
60 K A -0.6448
61 F A -0.0423
62 I A -0.0561
63 E A -1.7907
64 V A 0.0000
65 Q A -2.2767
66 K A -2.9509
67 N A -2.7347
68 A A -2.6674
69 E A -3.9622
70 R A -3.4110
71 A A -3.6096
72 R A -3.7445
73 N A -2.9599
74 T A 0.0000
75 Q A -3.4627
76 E A -3.4714
77 K A -2.5557
78 S A 0.0000
79 N A -3.0538
80 E A -2.6777
81 M A 0.0000
82 D A -2.8649
83 E A -3.0877
84 V A 0.0000
85 I A -2.6402
86 A A -2.1881
87 K A -3.2677
88 A A 0.0000
89 A A -2.4988
90 K A -2.7280
91 G A -2.9136
92 D A -3.1307
93 A A -2.3939
94 K A -2.9506
95 T A -2.9482
96 K A -3.4205
97 E A -3.1381
98 E A -3.4771
99 V A 0.0000
100 P A -2.3438
101 E A -2.9612
102 D A -2.6512
103 V A 0.0000
104 I A -2.3275
105 K A -3.6082
106 Y A -2.5432
107 M A 0.0000
108 R A -3.2882
109 D A -3.2448
110 N A -2.0967
111 G A -1.5077
112 I A 0.0000
113 L A -0.0879
114 I A 0.0000
115 D A -1.6065
116 G A -0.9823
117 M A -1.0963
118 T A -1.1924
119 I A 0.0000
120 D A -2.4985
121 D A -2.4836
122 Y A 0.0000
123 M A -1.5676
124 A A -1.7762
125 K A -1.9576
126 Y A -0.6517
127 G A -2.0545
128 D A -2.4601
129 H A -2.3099
130 G A -2.4153
131 K A -3.0467
132 L A 0.0000
133 D A -2.9384
134 K A -2.6516
135 G A -1.5356
136 G A 0.0000
137 L A 0.0000
138 Q A -1.5436
139 A A -0.9111
140 I A 0.0000
141 K A -1.4466
142 A A -1.0401
143 A A -0.9491
144 L A 0.0000
145 D A -2.2599
146 N A -2.4697
147 D A -2.2535
148 A A 0.0000
149 N A -3.3380
150 R A -3.3492
151 N A 0.0000
152 T A -2.4056
153 D A -2.5046
154 L A -1.2782
155 M A -1.6562
156 S A -0.7898
157 Q A -0.8235
158 G A 0.0000
159 Q A -0.8466
160 I A 0.3384
161 T A -0.4406
162 I A -0.9611
163 Q A -2.1004
164 K A -2.8052
165 M A 0.0000
166 S A -2.1584
167 Q A -3.0990
168 E A -2.7690
169 L A 0.0000
170 N A -2.1687
171 A A -1.4369
172 V A 0.0000
173 L A -0.2216
174 T A -0.5445
175 Q A -0.8352
176 L A 0.0000
177 T A 0.0413
178 G A -0.4275
179 L A -0.0507
180 I A 0.5265
181 S A -0.8724
182 K A -1.7831
183 W A -0.5499
184 G A -0.8833
185 E A -1.6842
186 I A -0.3113
187 S A 0.1781
188 S A -0.5139
189 M A 0.3382
190 I A 0.9172
191 A A -0.0936
192 Q A -0.8667
193 K A -1.2597
194 T A -0.1776
195 Y A 0.4863
196 S A -0.4861
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018