Project name: query_structure

Status: done

Started: 2026-03-17 00:46:25
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVWNNGMAWYRQAPGKEREWVAAIASRGRSTVYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCYVNVGSHYEGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)
Show buried residues

Minimal score value
-3.8325
Maximal score value
0.9263
Average score
-0.9636
Total score value
-109.8504

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.2926
2 V A -0.7081
3 Q A -0.9640
4 L A 0.0000
5 V A 0.5923
6 E A 0.0000
7 S A -0.6308
8 G A -1.0484
9 G A -0.8640
10 G A -0.0900
11 L A 0.9263
12 V A 0.0000
13 Q A -1.2953
14 A A -1.3931
15 G A -1.3030
16 G A -0.8720
17 S A -1.1945
18 L A -0.9402
19 R A -2.1454
20 L A 0.0000
21 S A -0.5189
22 C A 0.0000
23 A A -0.2307
24 A A 0.0000
25 S A -0.5701
26 G A -0.8532
27 F A -0.3936
28 P A -0.8128
29 V A 0.0000
30 W A -1.5418
31 N A -1.7825
32 N A -1.2529
33 G A -1.2422
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A -0.3526
38 R A 0.0000
39 Q A -2.1901
40 A A -2.1542
41 P A -1.5290
42 G A -2.0532
43 K A -3.4833
44 E A -3.8325
45 R A -3.2900
46 E A -1.7855
47 W A -0.4977
48 V A 0.0000
49 A A 0.0000
50 A A 0.4495
51 I A 0.0000
52 A A -1.1926
53 S A -2.0555
54 R A -3.1345
55 G A -2.5670
56 R A -2.6243
57 S A -1.1951
58 T A 0.0912
59 V A 0.8897
60 Y A -0.2161
61 A A -1.0180
62 D A -2.2581
63 S A -1.7142
64 V A 0.0000
65 K A -2.4323
66 G A -1.7630
67 R A -1.4280
68 F A 0.0000
69 T A -0.6996
70 I A 0.0000
71 S A -0.9770
72 R A -2.1863
73 D A -2.4438
74 N A -2.7723
75 A A -1.7494
76 K A -2.5854
77 N A -1.8682
78 T A 0.0000
79 V A 0.0000
80 Y A -0.9372
81 L A 0.0000
82 Q A -1.2580
83 M A 0.0000
84 N A -1.3354
85 S A -1.1369
86 L A 0.0000
87 K A -2.1867
88 P A -1.8988
89 E A -2.3049
90 D A 0.0000
91 T A -0.9802
92 A A 0.0000
93 V A -0.7407
94 Y A 0.0000
95 Y A -0.5594
96 C A 0.0000
97 Y A -0.9581
98 V A 0.0000
99 N A -1.7754
100 V A -0.6573
101 G A -0.8236
102 S A -1.1394
103 H A -1.7573
104 Y A -1.4035
105 E A -2.1243
106 G A -1.0591
107 Q A -1.4481
108 G A 0.0000
109 T A 0.0000
110 Q A -1.1925
111 V A 0.0000
112 T A -0.3627
113 V A 0.0000
114 S A -0.7710
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018