Project name: query_structure

Chain sequence(s)	A: EVQLQASGGGSVPPGGSLRLSCTASLRAFSTYTMGWFRQAPGKEREFVAASNWRGTDFHDSVRGRFIISRDNTEKTVDLQMNSLKPEDTAIYYCAADGSTWLKRSDYSYWGQGTQVTVS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)

• Minimal score value: -3.6359
• Maximal score value: 0.9488
• Average score: -0.8865
• Total score value: -105.489

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0989
2	V	A	-1.2376
3	Q	A	-1.8249
4	L	A	0.0000
5	Q	A	-1.7767
6	A	A	-1.1937
7	S	A	-1.3007
8	G	A	-1.2306
9	G	A	-1.1823
10	G	A	-0.9481
11	S	A	-0.5660
12	V	A	-0.4659
13	P	A	-0.7989
14	P	A	-1.3847
15	G	A	-1.2077
16	G	A	-0.8283
17	S	A	-1.0531
18	L	A	-1.0774
19	R	A	-1.9257
20	L	A	0.0000
21	S	A	-1.0623
22	C	A	0.0000
23	T	A	-1.1647
24	A	A	0.0000
25	S	A	-0.8281
26	L	A	-0.2454
27	R	A	-1.5937
28	A	A	0.0000
29	F	A	0.0000
30	S	A	-0.5721
31	T	A	-0.2438
32	Y	A	0.0242
33	T	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	-1.4802
39	Q	A	-2.1732
40	A	A	-2.0160
41	P	A	-1.3981
42	G	A	-1.9449
43	K	A	-3.3887
44	E	A	-3.6359
45	R	A	-2.9382
46	E	A	-2.5912
47	F	A	0.0000
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.0000
51	S	A	0.0000
52	N	A	-0.0375
53	W	A	0.2790
54	R	A	-1.1784
55	G	A	-0.6689
56	T	A	-0.2142
57	D	A	-0.7822
58	F	A	-1.0543
59	H	A	-1.9215
60	D	A	-2.6259
61	S	A	-1.8835
62	V	A	0.0000
63	R	A	-2.5793
64	G	A	-1.5106
65	R	A	-0.9370
66	F	A	0.0000
67	I	A	0.9488
68	I	A	0.0000
69	S	A	-0.4597
70	R	A	-1.5416
71	D	A	-2.5639
72	N	A	-2.4966
73	T	A	-1.9447
74	E	A	-2.6768
75	K	A	-2.2472
76	T	A	0.0000
77	V	A	0.0000
78	D	A	-0.9131
79	L	A	0.0000
80	Q	A	-0.4517
81	M	A	0.0000
82	N	A	-0.9503
83	S	A	-1.1294
84	L	A	0.0000
85	K	A	-2.3651
86	P	A	-1.8765
87	E	A	-2.4085
88	D	A	0.0000
89	T	A	-1.1840
90	A	A	0.0000
91	I	A	-0.4860
92	Y	A	0.0000
93	Y	A	-0.6681
94	C	A	0.0000
95	A	A	0.0000
96	A	A	0.0000
97	D	A	0.0000
98	G	A	-0.2609
99	S	A	-0.1346
100	T	A	0.2677
101	W	A	0.7115
102	L	A	-0.0150
103	K	A	-1.4474
104	R	A	-2.1994
105	S	A	-2.2244
106	D	A	-2.3275
107	Y	A	0.0000
108	S	A	-0.4210
109	Y	A	-0.0136
110	W	A	0.0021
111	G	A	-0.9257
112	Q	A	-1.5022
113	G	A	-1.0174
114	T	A	-1.0919
115	Q	A	-1.2830
116	V	A	0.0000
117	T	A	-0.8869
118	V	A	0.0000
119	S	A	-0.8372