Project name: query_structure

Status: done

Started: 2026-03-17 01:03:44
Settings
Chain sequence(s) A: SVSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYTMSEYYSYSDLYSYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-2.5333
Maximal score value
1.7067
Average score
-0.2743
Total score value
-26.8785

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A 0.5661
2 V A 1.7067
3 S A 0.7245
4 S A 0.7465
5 V A 0.6823
6 P A 0.0000
7 T A -1.2749
8 K A -2.3647
9 L A 0.0000
10 E A -1.7741
11 V A 0.1679
12 V A 1.5951
13 A A 0.9456
14 A A 0.3538
15 T A -0.1482
16 P A -1.0878
17 T A -0.9801
18 S A -0.4843
19 L A 0.0000
20 L A 0.8695
21 I A 0.0000
22 S A -0.7129
23 W A 0.0000
24 D A -1.6530
25 A A -0.6914
26 P A 0.2782
27 A A 0.5789
28 V A 0.8798
29 T A -0.0168
30 V A 0.0135
31 V A -0.0690
32 H A -0.3349
33 Y A 0.0000
34 V A 0.0000
35 I A 0.0000
36 T A -0.5270
37 Y A -0.3989
38 G A 0.0000
39 E A -1.6934
40 T A -1.2738
41 G A -1.2584
42 G A -1.4584
43 N A -1.5622
44 S A -0.9017
45 P A -0.4080
46 V A 0.2635
47 Q A -1.1975
48 E A -1.7111
49 F A -0.6423
50 T A -0.2105
51 V A 0.0000
52 P A -0.6222
53 G A -0.5906
54 S A -0.8826
55 K A -1.5804
56 S A -0.9940
57 T A -0.4860
58 A A 0.0000
59 T A 0.1176
60 I A 0.0000
61 S A -0.6326
62 G A -1.0182
63 L A 0.0000
64 K A -2.3662
65 P A -1.6496
66 G A -1.4494
67 V A -1.4451
68 D A -2.1254
69 Y A 0.0000
70 T A -0.7899
71 I A 0.0000
72 T A -0.0962
73 V A 0.0000
74 Y A 0.4589
75 T A 0.0000
76 M A 0.6064
77 S A 0.5213
78 E A -0.3988
79 Y A 1.5356
80 Y A 1.6684
81 S A 1.0778
82 Y A 1.4229
83 S A 0.3524
84 D A -0.6558
85 L A 1.2980
86 Y A 1.1320
87 S A 1.0277
88 Y A 1.5267
89 S A 0.7283
90 S A 0.1643
91 P A 0.1268
92 I A 0.0726
93 S A -0.5131
94 I A -0.7045
95 N A -1.7446
96 Y A -1.4863
97 R A -2.5333
98 T A -1.4880
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018