Project name: query_structure

Status: done

Started: 2026-03-16 21:41:21
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWIAPDAAFDSFIIVYRENIETGEAIVLTVPGSERSYDLTGLKPGTEYYVQIAGVKGGNISFPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-3.108
Maximal score value
2.4187
Average score
-0.4798
Total score value
-43.1864

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.5643
2 L A 1.1671
3 P A 0.5655
4 A A 0.7566
5 P A 0.0000
6 K A -1.5155
7 N A -1.1043
8 L A 0.0521
9 V A 1.2998
10 V A 0.6282
11 S A -0.6388
12 R A -2.0354
13 V A -1.1088
14 T A -1.8434
15 E A -3.1049
16 D A -2.8276
17 S A -2.1192
18 A A 0.0000
19 R A -1.1968
20 L A 0.0000
21 S A -0.0849
22 W A 0.0000
23 I A 0.0939
24 A A 0.0000
25 P A -1.0870
26 D A -2.1129
27 A A -1.4314
28 A A -1.1699
29 F A 0.0000
30 D A -2.6121
31 S A -1.1003
32 F A 0.0000
33 I A 1.1277
34 I A 0.0000
35 V A 1.0419
36 Y A 0.5989
37 R A -0.9173
38 E A -2.2589
39 N A -1.2885
40 I A -0.0131
41 E A -1.7481
42 T A -1.4386
43 G A -1.8275
44 E A -1.9267
45 A A -0.2196
46 I A 0.9654
47 V A 2.1243
48 L A 1.4951
49 T A 0.6046
50 V A 0.0000
51 P A -1.0746
52 G A 0.0000
53 S A -1.6286
54 E A -1.3847
55 R A -0.8069
56 S A -0.4445
57 Y A -0.6965
58 D A -1.5766
59 L A 0.0000
60 T A -1.3524
61 G A -1.5271
62 L A 0.0000
63 K A -3.1080
64 P A -2.4890
65 G A -1.7778
66 T A -1.9503
67 E A -1.0902
68 Y A 0.0000
69 Y A 0.6380
70 V A 0.0000
71 Q A 0.5547
72 I A 0.0000
73 A A 0.0000
74 G A 0.0000
75 V A -0.2753
76 K A -1.6337
77 G A -1.5231
78 G A -1.2891
79 N A -0.6704
80 I A 1.6932
81 S A 0.0000
82 F A 2.4187
83 P A 1.0296
84 L A 0.0733
85 S A 0.6011
86 A A 1.1916
87 I A 2.1008
88 F A 0.0000
89 T A -0.6832
90 T A -1.8593
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018