Project name: query_structure

Status: done

Started: 2026-03-17 01:11:20
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYYAYFQEFEVPGSKSTATISGLKPGVDYTITVYAAGYGYAYGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-3.411
Maximal score value
2.3147
Average score
-0.4367
Total score value
-39.7399

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.5232
2 S A 0.0059
3 D A -0.7431
4 V A -0.6218
5 P A 0.0000
6 R A -3.2817
7 D A -3.4110
8 L A 0.0000
9 E A -2.0957
10 V A 0.1470
11 V A 1.5786
12 A A 0.9229
13 A A 0.3382
14 T A -0.3308
15 P A -1.1095
16 T A -0.9915
17 S A -0.5153
18 L A 0.0000
19 L A 0.8017
20 I A 0.0000
21 S A -1.1452
22 W A 0.0000
23 D A -3.2388
24 A A -1.7555
25 P A -0.6743
26 A A 0.2336
27 V A 0.3110
28 T A -0.1824
29 V A -0.7351
30 D A -1.3397
31 Y A -1.2050
32 Y A 0.0000
33 V A 0.0000
34 I A 0.0000
35 T A -0.8725
36 Y A 0.0000
37 G A 0.0000
38 E A -0.4546
39 T A -0.2669
40 G A 0.4032
41 Y A 2.0278
42 Y A 2.3147
43 A A 1.6896
44 Y A 1.8324
45 F A 0.8441
46 Q A -1.2281
47 E A -2.1353
48 F A -1.4510
49 E A -1.9135
50 V A 0.0000
51 P A -1.5831
52 G A -1.6371
53 S A -1.4039
54 K A -2.0524
55 S A -1.4307
56 T A -0.7573
57 A A 0.0000
58 T A 0.0791
59 I A 0.0000
60 S A -0.6532
61 G A -1.0263
62 L A 0.0000
63 K A -2.3802
64 P A -1.6781
65 G A -1.4832
66 V A -1.4785
67 D A -2.1514
68 Y A 0.0000
69 T A -0.5780
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A 0.2055
74 A A 0.0000
75 A A 0.0000
76 G A 0.3258
77 Y A 1.1440
78 G A 0.7113
79 Y A 1.5321
80 A A 1.2907
81 Y A 1.3630
82 G A 0.2516
83 S A -0.1727
84 P A -0.1589
85 I A -0.3418
86 S A -0.7238
87 I A -0.7477
88 N A -1.7567
89 Y A -1.4931
90 R A -2.5699
91 T A -1.6606
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018