Project name: riapp1

Chain sequence(s)	A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:08)

• Minimal score value: -1.7654
• Maximal score value: 2.3111
• Average score: 0.032
• Total score value: 1.185

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-1.7654
2	C	A	-0.6387
3	N	A	-1.3547
4	T	A	-0.8340
5	A	A	-0.5617
6	T	A	-0.8101
7	C	A	-0.8634
8	A	A	-1.2137
9	T	A	-0.5673
10	Q	A	-1.6411
11	R	A	-1.2704
12	L	A	1.2737
13	A	A	0.8187
14	N	A	0.6936
15	F	A	2.3111
16	L	A	2.2677
17	V	A	1.8295
18	R	A	-0.3877
19	S	A	0.1795
20	S	A	-0.3890
21	N	A	-1.5779
22	N	A	-1.5965
23	L	A	0.3104
24	G	A	0.4273
25	P	A	0.8775
26	V	A	2.1529
27	L	A	1.8012
28	P	A	0.5666
29	P	A	0.2296
30	T	A	0.1595
31	N	A	-0.2130
32	V	A	0.9611
33	G	A	0.2737
34	S	A	-0.4300
35	N	A	-0.9951
36	T	A	0.0573
37	Y	A	1.1038