Project name: query_structure

Status: done

Started: 2026-03-16 23:04:33
Settings
Chain sequence(s) A: DVQLVESGGGSVQAGGSLRLSCAVSGSTYSPCTCGWYRQAPGKEREWVCSISSPGTIYYQDSVKGRFTCSRDNAKNTCYLQMNSLQREDTGMYYCQIQCGVRSIREYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:56)
Show buried residues

Minimal score value
-3.5201
Maximal score value
1.3804
Average score
-0.8016
Total score value
-94.5929

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.0903
2 V A -1.3294
3 Q A -1.1150
4 L A 0.0000
5 V A 0.7874
6 E A 0.0000
7 S A -0.5486
8 G A -1.2970
9 G A -1.1571
10 G A -0.8661
11 S A -0.6801
12 V A -0.8464
13 Q A -1.7166
14 A A -1.8638
15 G A -1.4902
16 G A -1.1228
17 S A -1.4550
18 L A -1.3694
19 R A -2.3866
20 L A 0.0000
21 S A -0.5403
22 C A 0.0000
23 A A -0.2514
24 V A -0.3568
25 S A -0.9474
26 G A -1.1631
27 S A -0.5820
28 T A -0.2471
29 Y A 1.0421
30 S A 0.4782
31 P A 0.1041
32 C A -0.1379
33 T A -0.3570
34 C A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A -0.2818
38 R A 0.0000
39 Q A -2.1066
40 A A -2.0756
41 P A -1.6433
42 G A -1.9843
43 K A -3.3464
44 E A -3.5201
45 R A -2.6918
46 E A -1.6899
47 W A -0.1726
48 V A 0.0000
49 C A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A 0.0187
53 S A -0.5229
54 P A -0.3497
55 G A -0.1641
56 T A 0.4238
57 I A 1.3804
58 Y A 1.3027
59 Y A -0.1083
60 Q A -1.2108
61 D A -2.4025
62 S A -1.8621
63 V A 0.0000
64 K A -2.5155
65 G A -1.8892
66 R A -1.7181
67 F A 0.0000
68 T A -0.8578
69 C A 0.0000
70 S A -0.6110
71 R A -1.4793
72 D A -2.1229
73 N A -2.4215
74 A A -1.8010
75 K A -2.5926
76 N A -2.1486
77 T A -1.3058
78 C A 0.0000
79 Y A 0.0000
80 L A 0.0000
81 Q A -1.7657
82 M A 0.0000
83 N A -2.0293
84 S A -1.3452
85 L A 0.0000
86 Q A -2.5452
87 R A -3.0431
88 E A -2.8566
89 D A 0.0000
90 T A -1.4907
91 G A 0.0000
92 M A -0.6714
93 Y A 0.0000
94 Y A -0.1934
95 C A 0.0000
96 Q A 0.0000
97 I A 0.0000
98 Q A -0.8129
99 C A 0.0000
100 G A 0.2396
101 V A 0.6732
102 R A -1.0980
103 S A -0.4354
104 I A 0.4748
105 R A -1.5212
106 E A -1.5781
107 Y A -0.6555
108 W A -0.0408
109 G A -0.1165
110 Q A -0.9007
111 G A 0.0000
112 T A 0.0000
113 Q A -1.3311
114 V A 0.0000
115 T A -1.1253
116 V A 0.0000
117 S A -1.3820
118 S A -1.0663
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018