Project name: 8479035b3d5b77c

Status: done

Started: 2026-03-28 08:41:31
Settings
Chain sequence(s) A: NKITVELIKKIFSIKNEEEYKKLIEDNGDIYIELENKEKYLKLKKEKKCKSLLLINSKEELEEEKNNEIYQLIKSEGGEPIYKEESDEYIEKEIKKIYE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:50)
Show buried residues

Minimal score value
-4.816
Maximal score value
1.5766
Average score
-2.2626
Total score value
-224.0015

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -1.6857
2 K A -1.6212
3 I A 0.2290
4 T A -0.3970
5 V A -0.9746
6 E A -1.9797
7 L A -1.0702
8 I A 0.0000
9 K A -2.0515
10 K A -2.6494
11 I A 0.0000
12 F A -0.7664
13 S A -1.1884
14 I A -2.4452
15 K A -2.8640
16 N A -3.1006
17 E A -3.9984
18 E A -4.2465
19 E A -3.6530
20 Y A -3.5211
21 K A -4.1549
22 K A -4.5180
23 L A -3.0615
24 I A -2.3835
25 E A -3.9436
26 D A -3.9355
27 N A -2.7588
28 G A -2.1321
29 D A -0.7648
30 I A 1.5766
31 Y A 1.3353
32 I A 1.1101
33 E A -1.2503
34 L A -1.5938
35 E A -3.1062
36 N A -2.9813
37 K A -3.2082
38 E A -3.2978
39 K A -3.0418
40 Y A 0.0000
41 L A -2.5091
42 K A -3.8566
43 L A -3.3301
44 K A -3.6417
45 K A -4.1208
46 E A -4.2156
47 K A -4.1067
48 K A -3.3043
49 C A -2.0056
50 K A -2.0746
51 S A -0.7920
52 L A -0.4700
53 L A -0.2253
54 L A 0.1253
55 I A 0.0000
56 N A -2.7748
57 S A -3.2181
58 K A -4.0169
59 E A -4.3210
60 E A -4.0545
61 L A 0.0000
62 E A -4.8160
63 E A -4.7535
64 E A -4.6367
65 K A -4.1729
66 N A -3.5897
67 N A -3.3178
68 E A -3.4163
69 I A 0.0000
70 Y A 0.0000
71 Q A -2.6341
72 L A -1.5020
73 I A 0.0000
74 K A -2.2234
75 S A -1.8271
76 E A -2.6110
77 G A -2.1232
78 G A -2.1467
79 E A -2.2256
80 P A 0.0000
81 I A 0.0000
82 Y A -2.1378
83 K A -3.1058
84 E A -3.6361
85 E A -3.1412
86 S A -2.5523
87 D A -3.7894
88 E A -3.1673
89 Y A -1.9898
90 I A 0.0000
91 E A -3.1173
92 K A -3.3308
93 E A -2.5302
94 I A 0.0000
95 K A -2.8244
96 K A -3.3744
97 I A -1.8966
98 Y A -1.8956
99 E A -2.5101
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018