Project name: 847a82fe1fe8432

Status: done

Started: 2026-06-22 16:03:29
Settings
Chain sequence(s) B: SALAAELEALEAQAAALWAQLQQAAADPELRMKLFVEYAKVVARRLELLK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-2.5531
Maximal score value
0.9183
Average score
-0.8502
Total score value
-42.5088

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B 0.0370
2 A B 0.0516
3 L B 0.7251
4 A B -0.0164
5 A B -0.7865
6 E B -1.4511
7 L B -1.1082
8 E B -2.4345
9 A B -1.6233
10 L B 0.0000
11 E B -2.1736
12 A B -1.2790
13 Q B -1.1163
14 A B -0.7583
15 A B -0.0865
16 A B -0.1506
17 L B 0.1154
18 W B 0.4128
19 A B -0.4380
20 Q B -0.8180
21 L B -0.7222
22 Q B -1.7735
23 Q B -1.9012
24 A B 0.0000
25 A B -1.0377
26 A B -0.9986
27 D B -1.7074
28 P B -1.8347
29 E B -2.3262
30 L B -1.3130
31 R B -1.7653
32 M B -0.4315
33 K B -1.3745
34 L B 0.0000
35 F B 0.9183
36 V B 0.2706
37 E B -0.9907
38 Y B 0.1153
39 A B -0.5582
40 K B -1.8679
41 V B 0.0000
42 V B -1.0602
43 A B -1.3715
44 R B -2.5531
45 R B -1.7878
46 L B -0.3481
47 E B -1.8976
48 L B -0.4070
49 L B 0.5658
50 K B -1.4525
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018