Project name: 84b4a6ed8fdb8a0

Status: done

Started: 2026-06-22 19:23:13
Settings
Chain sequence(s) B: ELRALMDEAMKAIKKLKELKELVEKQNPDEELAKRLDEKLKKLEEKVKAL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:14)
Show buried residues

Minimal score value
-4.9634
Maximal score value
0.3467
Average score
-2.6633
Total score value
-133.1633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -1.7357
2 L B -0.5548
3 R B -2.0525
4 A B -1.5837
5 L B -0.5917
6 M B -1.5877
7 D B -3.1484
8 E B -3.0639
9 A B -2.3522
10 M B -2.5438
11 K B -3.4815
12 A B -2.6415
13 I B 0.0000
14 K B -3.5653
15 K B -2.9743
16 L B -1.5091
17 K B -2.7212
18 E B -2.7902
19 L B -1.0369
20 K B -1.6831
21 E B -2.4175
22 L B -1.2432
23 V B -1.5884
24 E B -3.6876
25 K B -3.2155
26 Q B -2.8521
27 N B -2.9508
28 P B -3.0137
29 D B -4.0181
30 E B -4.3094
31 E B -4.0036
32 L B -3.1632
33 A B 0.0000
34 K B -4.7579
35 R B -4.6601
36 L B -3.5582
37 D B -3.9583
38 E B -4.9062
39 K B -4.4998
40 L B 0.0000
41 K B -4.9634
42 K B -4.9243
43 L B -3.5003
44 E B -4.0920
45 E B -4.3082
46 K B -3.4412
47 V B 0.0000
48 K B -2.6337
49 A B -1.2258
50 L B 0.3467
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018