Project name: query_structure

Status: done

Started: 2026-03-16 20:30:57
Settings
Chain sequence(s) A: LPAPKNLVVSRVTEDSARLSWALSSVHAYFDSFLIQYQESEKVGEAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVQYVDGFFKSNPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:02)
Show buried residues

Minimal score value
-2.9866
Maximal score value
2.4172
Average score
-0.3458
Total score value
-32.5011

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.5148
2 P A -0.3067
3 A A -0.9360
4 P A 0.0000
5 K A -1.9980
6 N A -1.4866
7 L A -0.1583
8 V A 1.2648
9 V A 0.7482
10 S A -0.5593
11 R A -1.9784
12 V A -0.9566
13 T A -1.7434
14 E A -2.9842
15 D A -2.6315
16 S A -1.9947
17 A A 0.0000
18 R A -1.1266
19 L A 0.0000
20 S A -0.3294
21 W A 0.0000
22 A A -0.6816
23 L A -0.1120
24 S A -0.3093
25 S A 0.3542
26 V A 1.4633
27 H A 0.1934
28 A A 0.7980
29 Y A 1.2417
30 F A 0.0000
31 D A 0.2269
32 S A -0.2923
33 F A 0.0000
34 L A 0.4991
35 I A 0.0000
36 Q A 0.6407
37 Y A 0.4900
38 Q A -0.7476
39 E A -1.8117
40 S A -1.5493
41 E A -2.4407
42 K A -2.0176
43 V A -0.0175
44 G A -0.9513
45 E A -1.5754
46 A A -0.2146
47 I A 1.0735
48 V A 2.0292
49 L A 1.3984
50 T A 0.4736
51 V A 0.0000
52 P A -0.7427
53 G A -0.5081
54 S A -0.6868
55 E A -1.0516
56 R A -0.8809
57 S A -0.5628
58 Y A -0.6253
59 D A -1.5565
60 L A 0.0000
61 T A -1.3897
62 G A -1.4628
63 L A 0.0000
64 K A -2.9866
65 P A -2.5323
66 G A -1.8574
67 T A -2.2507
68 E A -1.9972
69 Y A 0.0000
70 T A 0.0276
71 V A 0.0000
72 S A 0.0000
73 I A 0.0000
74 Y A -0.2622
75 G A 0.0000
76 V A 0.0000
77 Q A 1.5046
78 Y A 2.1343
79 V A 1.8635
80 D A -0.2817
81 G A 0.8108
82 F A 2.4172
83 F A 1.7947
84 K A -0.0842
85 S A 0.0000
86 N A -1.3801
87 P A -0.9995
88 L A -0.7463
89 S A 0.0395
90 A A 1.1921
91 I A 1.8082
92 F A 0.0000
93 T A -0.8341
94 T A -1.9133
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018