Project name: obj1 [mutate: GC10C, WL47C, YN95C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GC10C,YN95C,WL47C
Energy difference between WT (input) and mutated protein (by FoldX)	6.81701 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:43)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)

• Minimal score value: -3.3174
• Maximal score value: 1.9955
• Average score: -0.6164
• Total score value: -73.9667

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9367
3	Q	C	-1.2709
4	L	C	0.0000
5	V	C	0.4993
6	E	C	0.1489
7	S	C	-0.2827
8	G	C	-0.5621
9	G	C	0.5592
10	C	C	1.8873	mutated: GC10C
11	L	C	1.8976
12	V	C	0.1685
13	Q	C	-1.3483
14	P	C	-1.4944
15	G	C	-1.4168
16	G	C	-0.9900
17	S	C	-1.2472
18	L	C	-0.8332
19	R	C	-2.1353
20	L	C	0.0000
21	S	C	-0.5265
22	C	C	0.0000
23	A	C	-0.2022
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.1329
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2262
40	A	C	-0.9536
41	P	C	-1.2906
42	G	C	-1.4168
43	K	C	-2.0996
44	G	C	-0.9926
45	L	C	0.5834
46	E	C	-0.1018
47	L	C	0.8046	mutated: WL47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5409
53	G	C	-1.2461
54	S	C	-1.2292
55	G	C	-1.0821
56	G	C	-0.7346
57	S	C	-0.2425
58	T	C	0.3411
59	Y	C	0.9109
60	Y	C	-0.1120
61	A	C	-0.9572
62	D	C	-2.3031
63	S	C	-1.7079
64	V	C	0.0000
65	K	C	-2.3335
66	G	C	-1.6115
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6344
70	I	C	0.0000
71	S	C	-0.5622
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6694
81	L	C	0.0000
82	Q	C	-1.2402
83	M	C	0.0000
84	N	C	-1.3382
85	S	C	-1.2351
86	L	C	0.0000
87	R	C	-2.4750
88	A	C	-1.8925
89	E	C	-2.3448
90	D	C	0.0000
91	T	C	-0.3299
92	A	C	0.0000
93	I	C	1.0887
94	Y	C	0.0000
95	N	C	0.3366	mutated: YN95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1752
101	D	C	-3.3174
102	G	C	-2.0546
103	F	C	-1.1354
104	N	C	-2.3972
105	K	C	-3.1647
106	G	C	-1.8853
107	F	C	-0.9857
108	D	C	-1.1261
109	Y	C	-0.2783
110	W	C	0.3337
111	G	C	-0.2495
112	Q	C	-0.9979
113	G	C	-0.0558
114	T	C	0.6684
115	L	C	1.9955
116	V	C	0.0000
117	T	C	0.5951
118	V	C	0.0000
119	S	C	-0.7804
120	S	C	-1.0628