Project name: query_structure

Status: done

Started: 2026-03-17 01:17:54
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWYYPFSAFYYRITYGETGGNSPVQEFTVPRPSDTATISGLKPGVDYTITVYAVTSLGSYSRPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)
Show buried residues

Minimal score value
-2.7396
Maximal score value
1.5816
Average score
-0.4993
Total score value
-44.941

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.3475
2 S A -0.3771
3 D A -1.5306
4 V A -0.7948
5 P A 0.0000
6 R A -1.5827
7 D A -2.2434
8 L A 0.0000
9 E A -1.6882
10 V A 0.1006
11 V A 1.5371
12 A A 0.8969
13 A A 0.3291
14 T A -0.3327
15 P A -1.0526
16 T A -0.9518
17 S A -0.5143
18 L A 0.0000
19 L A 0.7692
20 I A 0.0000
21 S A -0.5283
22 W A 0.0000
23 Y A 0.0671
24 Y A -0.0137
25 P A 0.3170
26 F A 0.7995
27 S A 0.1404
28 A A 0.0000
29 F A 1.5672
30 Y A 0.2173
31 Y A 0.0000
32 R A -0.4960
33 I A 0.0000
34 T A -0.6404
35 Y A -0.4357
36 G A -0.8690
37 E A -1.8749
38 T A -1.5152
39 G A -1.3604
40 G A -1.5414
41 N A -1.5783
42 S A -0.9557
43 P A -0.4285
44 V A 0.2499
45 Q A -1.2153
46 E A -1.8303
47 F A -0.7423
48 T A -0.5469
49 V A 0.0000
50 P A -0.8925
51 R A -1.7727
52 P A -1.3656
53 S A -1.2384
54 D A -1.0453
55 T A -0.4815
56 A A 0.0000
57 T A 0.2452
58 I A 0.0000
59 S A -0.6561
60 G A -1.0251
61 L A 0.0000
62 K A -2.3964
63 P A -1.6162
64 G A -1.3278
65 V A -1.6156
66 D A -2.7018
67 Y A 0.0000
68 T A -0.9432
69 I A 0.0000
70 T A -0.3143
71 V A 0.0000
72 Y A -0.1742
73 A A 0.0000
74 V A 0.0000
75 T A 1.2910
76 S A 1.1833
77 L A 1.5816
78 G A 0.7043
79 S A 0.5621
80 Y A 0.4087
81 S A 0.0000
82 R A -1.8768
83 P A -0.8968
84 I A -0.4200
85 S A -0.3898
86 I A -0.5142
87 N A -1.8805
88 Y A -1.6427
89 R A -2.7396
90 T A -1.6884
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018