Project name: obj1 [mutate: GA9C, WC47C, YG95C, WH110C, TM114C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TM114C,GA9C,WC47C,YG95C,WH110C
Energy difference between WT (input) and mutated protein (by FoldX)	14.2406 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:05)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)

• Minimal score value: -3.2269
• Maximal score value: 2.1454
• Average score: -0.6426
• Total score value: -77.1114

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0054
2	V	C	-1.1297
3	Q	C	-1.5683
4	L	C	0.0000
5	V	C	0.3235
6	E	C	0.0000
7	S	C	-0.0959
8	G	C	-0.4965
9	A	C	0.4755	mutated: GA9C
10	G	C	1.1562
11	L	C	1.4925
12	V	C	-0.0030
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.8997
19	R	C	-2.0769
20	L	C	0.0000
21	S	C	-0.3922
22	C	C	0.0000
23	A	C	-0.2005
24	A	C	0.0000
25	S	C	-0.2233
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.0699
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3053
40	A	C	-0.9766
41	P	C	-1.2958
42	G	C	-1.4470
43	K	C	-2.1430
44	G	C	-1.0346
45	L	C	0.5614
46	E	C	-0.1967
47	C	C	0.6658	mutated: WC47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5364
53	G	C	-1.2460
54	S	C	-1.2291
55	G	C	-1.0820
56	G	C	-0.7344
57	S	C	-0.2352
58	T	C	0.3563
59	Y	C	0.9432
60	Y	C	-0.1171
61	A	C	-0.9785
62	D	C	-2.2984
63	S	C	-1.7065
64	V	C	0.0000
65	K	C	-2.3285
66	G	C	-1.6113
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6316
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6361
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4722
88	A	C	-1.8895
89	E	C	-2.3445
90	D	C	0.0000
91	T	C	-0.3983
92	A	C	0.0000
93	I	C	1.4138
94	Y	C	0.0000
95	G	C	0.0000	mutated: YG95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.9725
101	D	C	-3.2269
102	G	C	-1.9856
103	F	C	-1.0556
104	N	C	-2.3221
105	K	C	-3.0399
106	G	C	-1.6029
107	F	C	-0.7020
108	D	C	-1.1831
109	Y	C	-0.8347
110	H	C	-1.0337	mutated: WH110C
111	G	C	-0.8765
112	Q	C	-1.1799
113	G	C	0.0891
114	M	C	1.1760	mutated: TM114C
115	L	C	2.1454
116	V	C	0.0000
117	T	C	0.4134
118	V	C	0.0000
119	S	C	-0.7745
120	S	C	-1.0601