Project name: query_structure

Status: done

Started: 2026-03-17 01:21:55
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKSTATISGLSPGVDYTITVYAYWEHMYHYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)
Show buried residues

Minimal score value
-2.5555
Maximal score value
1.8406
Average score
-0.3581
Total score value
-32.5878

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8406
2 S A 0.8890
3 S A 0.8036
4 V A 0.5613
5 P A 0.0000
6 T A -1.5414
7 K A -2.5555
8 L A 0.0000
9 E A -1.8968
10 V A 0.1096
11 V A 1.5470
12 A A 0.9028
13 A A 0.3245
14 T A -0.1940
15 P A -0.7998
16 T A -0.5267
17 S A -0.3065
18 L A 0.0000
19 L A 0.7606
20 I A 0.0000
21 S A -0.9161
22 W A 0.0000
23 D A -2.4518
24 A A -1.1140
25 P A 0.1468
26 A A 0.5739
27 V A 0.7397
28 T A -0.4336
29 V A -0.9933
30 D A -2.1359
31 H A -1.5031
32 Y A 0.0000
33 V A 0.0688
34 I A 0.0000
35 T A -0.7719
36 Y A 0.0000
37 G A 0.0000
38 E A -0.9452
39 T A -0.9456
40 G A -0.2882
41 A A 0.5223
42 Y A 1.7297
43 W A 1.6455
44 S A 0.4138
45 Y A 0.0650
46 Q A -1.3748
47 E A -1.8567
48 F A -0.5465
49 T A -0.1735
50 V A 0.0000
51 P A -1.2469
52 G A -1.4675
53 S A -1.4220
54 K A -1.9703
55 S A -1.3643
56 T A -0.7038
57 A A 0.0000
58 T A 0.2414
59 I A 0.0000
60 S A -0.4711
61 G A -0.6807
62 L A 0.0000
63 S A -0.8487
64 P A -1.0060
65 G A -1.1293
66 V A -1.0197
67 D A -1.9603
68 Y A 0.0000
69 T A -0.9566
70 I A 0.0000
71 T A -0.1871
72 V A 0.0000
73 Y A 0.7057
74 A A 0.0000
75 Y A 0.0015
76 W A -0.7559
77 E A -2.1126
78 H A -1.0607
79 M A 0.7397
80 Y A 1.3643
81 H A 0.5874
82 Y A 1.4925
83 S A 0.7569
84 P A 0.4530
85 I A 0.2949
86 S A -0.5134
87 I A -0.7257
88 N A -1.7944
89 Y A -1.5519
90 R A -2.4256
91 T A -1.2242
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018