Project name: 1-1

Status: done

Started: 2026-05-26 06:55:21
Settings
Chain sequence(s) A: KPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:00)
Show buried residues

Minimal score value
-4.8692
Maximal score value
1.5546
Average score
-1.5203
Total score value
-275.1676

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.8906
2 P A -1.6722
3 H A -0.9640
4 I A 0.6807
5 D A -0.8411
6 N A -0.8273
7 Y A 0.6850
8 L A 0.2120
9 H A -1.2155
10 D A -1.8290
11 K A -3.1377
12 D A -3.4393
13 K A 0.0000
14 D A -4.4521
15 E A -4.8692
16 K A -3.8221
17 I A 0.0000
18 E A -4.2993
19 Q A -4.0827
20 Y A 0.0000
21 D A -3.6781
22 K A -4.5058
23 N A -4.1377
24 V A -3.5118
25 K A -4.5139
26 E A -4.7234
27 Q A -4.4745
28 A A -4.2650
29 S A -3.5851
30 K A -4.3436
31 D A -4.6758
32 K A -4.3249
33 K A -4.0180
34 Q A -3.7927
35 Q A -3.2802
36 A A -2.4846
37 K A -2.9302
38 P A -2.0672
39 Q A -1.8884
40 I A -1.1286
41 P A -1.6949
42 K A -2.7051
43 D A -2.1691
44 K A -2.3625
45 S A -1.9309
46 K A -2.2471
47 V A -0.9570
48 A A 0.0000
49 G A 0.0000
50 Y A -0.1424
51 I A 0.0000
52 E A -1.2352
53 I A 0.0000
54 P A -1.8444
55 D A -2.9867
56 A A 0.0000
57 D A -2.7819
58 I A 0.0000
59 K A -1.5386
60 E A 0.0000
61 P A 0.0000
62 V A 0.0000
63 Y A 0.0000
64 P A 0.0000
65 G A 0.0000
66 P A -2.0831
67 A A -1.1717
68 T A -1.3402
69 P A -1.6554
70 E A -2.6544
71 Q A 0.0000
72 L A 0.0000
73 N A -2.5093
74 R A -2.4589
75 G A 0.0000
76 V A 0.0000
77 S A 0.0000
78 F A 0.0000
79 A A -1.3445
80 E A -2.9528
81 E A -3.5555
82 N A -2.7293
83 E A -2.1779
84 S A -1.7515
85 L A 0.0000
86 D A -2.3299
87 D A -1.6608
88 Q A -2.6203
89 N A 0.0000
90 I A 0.0000
91 S A 0.0000
92 I A 0.0000
93 A A 0.0000
94 G A 0.0000
95 H A -0.0751
96 T A 0.0423
97 F A 1.4428
98 I A 1.5546
99 D A -0.7790
100 R A -0.7123
101 P A -0.4661
102 N A -0.8140
103 Y A -0.2792
104 Q A 0.0000
105 F A 0.0000
106 T A 0.0000
107 N A -1.2141
108 L A 0.0000
109 K A -2.2869
110 A A -2.0509
111 A A 0.0000
112 K A -3.2339
113 K A -2.7602
114 G A -2.2201
115 S A 0.0000
116 M A -1.2567
117 V A 0.0000
118 Y A -0.5548
119 F A 0.0000
120 K A -0.8677
121 V A 0.0000
122 G A -2.0612
123 N A -2.5217
124 E A -1.8438
125 T A -1.0829
126 R A -1.1250
127 K A -1.6353
128 Y A 0.0000
129 K A -1.6174
130 M A 0.0000
131 T A -1.0665
132 S A -0.9358
133 I A -1.4195
134 R A -2.5477
135 D A -3.5630
136 V A 0.0000
137 K A -2.8686
138 P A -1.5193
139 T A -0.7145
140 D A -1.0066
141 V A 0.6262
142 G A -0.4792
143 V A -0.1007
144 L A -0.6623
145 D A -2.0788
146 E A -2.6860
147 Q A -3.3398
148 K A -3.4465
149 G A -2.7513
150 K A -3.5458
151 D A -3.4495
152 K A -2.7452
153 Q A 0.0000
154 L A 0.0000
155 T A 0.0000
156 L A 0.0000
157 I A 0.0000
158 T A 0.0000
159 C A 0.0000
160 D A -1.8626
161 D A -2.7346
162 Y A -1.7584
163 N A -2.1683
164 E A -2.9204
165 K A -2.6866
166 T A -1.6207
167 G A -1.4517
168 V A -1.1176
169 W A -1.8129
170 E A -2.7875
171 K A -3.5053
172 R A -3.0750
173 K A -2.7555
174 I A 0.0000
175 F A 0.0000
176 V A -0.1787
177 A A 0.0000
178 T A -1.4171
179 E A -1.6196
180 V A -1.3041
181 K A -1.9868
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018