Project name: query_structure

Status: done

Started: 2026-03-16 19:57:04
Settings
Chain sequence(s) A: DYKDDDDKLKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:49)
Show buried residues

Minimal score value
-4.2956
Maximal score value
2.186
Average score
-1.2178
Total score value
-86.4614

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.7832
2 Y A -0.8775
3 K A -3.1209
4 D A -4.2359
5 D A -4.2133
6 D A -4.2956
7 D A -4.2746
8 K A -3.4701
9 L A -2.2276
10 K A -2.1805
11 P A -0.8567
12 D A -0.6351
13 F A 0.9078
14 C A 0.0000
15 F A -0.4225
16 L A -0.1564
17 E A -2.0473
18 E A -2.2783
19 D A -1.3632
20 P A -0.5768
21 G A 0.6682
22 I A 1.9496
23 C A 0.6757
24 R A -1.2380
25 G A -0.5610
26 Y A -0.1819
27 I A 0.4209
28 T A -0.8163
29 R A -1.6095
30 Y A -2.1909
31 F A 0.0000
32 Y A 0.0000
33 N A -2.4178
34 N A -2.4100
35 Q A -2.4675
36 T A -2.1499
37 K A -2.9926
38 Q A -2.5103
39 C A 0.0000
40 E A -2.5509
41 R A -2.8142
42 F A 0.0000
43 K A -2.2060
44 Y A -0.8174
45 G A 0.0000
46 G A 0.6885
47 C A 1.6011
48 L A 2.1860
49 G A 0.7430
50 N A 0.0268
51 M A 0.6808
52 N A 0.0000
53 N A -1.2146
54 F A -1.3922
55 E A -2.2335
56 T A -2.1080
57 L A -2.1155
58 E A -2.9894
59 E A -2.6038
60 C A 0.0000
61 K A -2.2855
62 N A -1.9409
63 I A -0.7791
64 C A 0.0000
65 E A -2.4315
66 D A -1.9397
67 G A -1.6040
68 P A -1.0230
69 N A -1.6988
70 G A -0.4646
71 F A 0.7640
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018