Project name: query_structure

Status: done

Started: 2026-03-16 22:53:11
Settings
Chain sequence(s) A: AENKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLSESQAPGGGC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-3.5612
Maximal score value
1.5256
Average score
-1.4913
Total score value
-90.9663

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -1.3960
2 E A -2.7460
3 N A -2.6524
4 K A -2.9086
5 F A -1.3854
6 N A -3.0185
7 K A -3.5157
8 E A -3.5612
9 M A 0.0000
10 R A -2.4784
11 N A -2.4838
12 A A 0.0000
13 Y A -0.4310
14 W A 0.4489
15 E A -0.2069
16 I A 0.0000
17 A A 0.2250
18 L A 1.5256
19 L A -0.0383
20 P A -0.5913
21 N A -1.2472
22 L A 0.0000
23 N A -2.7729
24 N A -3.1578
25 Q A -3.0154
26 Q A -2.4308
27 K A -2.4231
28 R A -3.3294
29 A A -2.0832
30 F A 0.0000
31 I A -1.1882
32 R A -2.3591
33 S A -1.6750
34 L A 0.0000
35 Y A -0.2645
36 D A -2.0647
37 D A -1.6434
38 P A -1.5296
39 S A -1.3532
40 Q A -1.6189
41 S A 0.0000
42 A A -1.4039
43 N A -1.8908
44 L A -1.4309
45 L A -1.1990
46 A A -1.8205
47 E A -2.8927
48 A A 0.0000
49 K A -2.7605
50 K A -3.2194
51 L A -1.8811
52 S A 0.0000
53 E A -3.1650
54 S A -1.9871
55 Q A -1.8924
56 A A -1.6076
57 P A -1.0845
58 G A -1.0939
59 G A -1.1042
60 G A -1.2036
61 C A 0.0412
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018