Project name: 399

Status: done

Started: 2026-03-19 14:24:24
Settings
Chain sequence(s) A: PGVKPIRLFFGQQRRDVYPSALRRLLRFIAPDLVITHMEAHVNEATGRGKGCAWVIVPSVLEAKRLLRLSGRIFLDINSNGEEVYLFAPPNCREWLSEYADYVVSSTTRASHLPYLPMVVGVPKKECIYVRELLAPYIYDPNRGDCPPYADAVSEFKGLLEDHASLPV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:17)
Show buried residues

Minimal score value
-2.9427
Maximal score value
1.6059
Average score
-0.5415
Total score value
-90.9667

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A 0.5729
2 G A 0.9158
3 V A 1.4702
4 K A -0.1426
5 P A -0.3726
6 I A 0.0000
7 R A -0.7538
8 L A 0.0000
9 F A 1.0152
10 F A 0.0000
11 G A 0.2984
12 Q A -0.1165
13 Q A -0.8784
14 R A -1.4363
15 R A -2.6310
16 D A -1.3398
17 V A -0.3747
18 Y A 0.4509
19 P A -0.8338
20 S A -0.9770
21 A A 0.0000
22 L A 0.0000
23 R A -2.7798
24 R A -2.8756
25 L A 0.0000
26 L A 0.0000
27 R A -2.3738
28 F A -0.6364
29 I A -0.2185
30 A A -0.8797
31 P A -1.4020
32 D A -1.6405
33 L A 0.0000
34 V A 1.0874
35 I A 0.4121
36 T A 0.1341
37 H A -1.0931
38 M A -1.1917
39 E A -1.6477
40 A A -1.1326
41 H A -1.4549
42 V A -1.7130
43 N A -2.2323
44 E A -2.5273
45 A A -1.2952
46 T A -1.3487
47 G A -1.8962
48 R A -2.8654
49 G A 0.0000
50 K A -2.9427
51 G A -2.1014
52 C A -0.8420
53 A A 0.0000
54 W A -0.4381
55 V A 0.0000
56 I A -0.0295
57 V A 0.0000
58 P A 0.5925
59 S A 0.9690
60 V A 0.7913
61 L A 1.6059
62 E A 0.4713
63 A A 0.0000
64 K A -0.2833
65 R A -0.7190
66 L A 0.0000
67 L A 0.0000
68 R A -0.7807
69 L A 0.0000
70 S A 0.0000
71 G A 0.1729
72 R A 0.0000
73 I A 0.0000
74 F A 0.0000
75 L A 0.0000
76 D A 0.2158
77 I A -0.4577
78 N A -1.3560
79 S A -1.4095
80 N A -2.1820
81 G A -1.9124
82 E A -2.2554
83 E A -0.9948
84 V A -0.0747
85 Y A 0.4785
86 L A 0.5845
87 F A 0.7365
88 A A 0.0000
89 P A 0.0000
90 P A 0.0000
91 N A -1.1773
92 C A -0.6783
93 R A 0.0000
94 E A -1.9638
95 W A -0.7613
96 L A 0.0000
97 S A -1.0567
98 E A -1.8580
99 Y A -0.4192
100 A A 0.0000
101 D A -1.0418
102 Y A 0.3043
103 V A 0.4494
104 V A 0.4925
105 S A -0.0022
106 S A -0.0983
107 T A 0.0603
108 T A -0.1846
109 R A -0.0272
110 A A -0.0949
111 S A -0.6009
112 H A -1.5919
113 L A 0.0000
114 P A 0.0000
115 Y A 1.1618
116 L A 0.9785
117 P A 0.0000
118 M A 0.0000
119 V A 1.5778
120 V A 0.0000
121 G A 0.5778
122 V A -0.4240
123 P A 0.0000
124 K A -2.2975
125 K A -2.3969
126 E A -1.0461
127 C A 0.2934
128 I A 1.4352
129 Y A 1.5212
130 V A 0.0000
131 R A -0.7719
132 E A -0.9818
133 L A -0.1016
134 L A 0.0000
135 A A -0.3913
136 P A -0.4437
137 Y A -0.0099
138 I A 0.5602
139 Y A -0.0334
140 D A -1.2180
141 P A -2.0613
142 N A -2.5500
143 R A -2.9353
144 G A -2.1527
145 D A -1.8024
146 C A -0.7926
147 P A -0.7087
148 P A -0.4767
149 Y A 0.2635
150 A A -0.3197
151 D A -1.7042
152 A A 0.0000
153 V A -0.3128
154 S A -1.0305
155 E A -1.1125
156 F A -0.3314
157 K A -1.7100
158 G A -1.5211
159 L A -0.7504
160 L A -0.3190
161 E A -2.3625
162 D A -2.5901
163 H A -1.0457
164 A A -0.4820
165 S A -0.1155
166 L A 0.0000
167 P A -0.3705
168 V A -0.5476
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018