Project name: 8706aaf5b1af219

Status: done

Started: 2026-07-01 15:23:34
Settings
Chain sequence(s) B: ESKVIQTHTVQVSAGGPLSSITFVWNGDHTLTVPLTLPAGSTVRLVAETE
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-2.9706
Maximal score value
1.6928
Average score
-0.5571
Total score value
-27.8573

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -2.8550
2 S B -2.5703
3 K B -2.2539
4 V B -0.2658
5 I B 0.7979
6 Q B -0.5940
7 T B -0.8749
8 H B -1.6480
9 T B -1.2438
10 V B -0.9246
11 Q B -1.4497
12 V B -0.6759
13 S B -0.7216
14 A B -0.6242
15 G B -0.6625
16 G B -0.5891
17 P B -0.4428
18 L B -0.1508
19 S B -0.0380
20 S B 0.2655
21 I B 0.9144
22 T B 1.2617
23 F B 1.6928
24 V B 1.5560
25 W B 0.3638
26 N B -1.3936
27 G B -1.4087
28 D B -2.3292
29 H B -1.1355
30 T B 0.4303
31 L B 1.5846
32 T B 1.1301
33 V B 0.9558
34 P B 0.3810
35 L B 0.5500
36 T B 0.1051
37 L B 0.0000
38 P B -0.5500
39 A B -0.7208
40 G B -0.8682
41 S B -0.5466
42 T B -0.8616
43 V B -0.9106
44 R B -1.8705
45 L B -0.9899
46 V B -0.3923
47 A B -0.5799
48 E B -1.7138
49 T B -2.0196
50 E B -2.9706
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018