Project name: 872b5ebd16f8437

Chain sequence(s)	A: SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)

• Minimal score value: -3.792
• Maximal score value: 1.5311
• Average score: -1.0246
• Total score value: -149.5969

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.8201
2	L	A	0.0000
3	S	A	-0.6302
4	A	A	-0.7039
5	A	A	-0.7388
6	E	A	-1.4687
7	A	A	-1.7056
8	D	A	-2.4601
9	L	A	-1.6513
10	A	A	0.0000
11	G	A	-1.8169
12	K	A	-2.2167
13	S	A	0.0000
14	W	A	0.0000
15	A	A	-0.5941
16	P	A	-0.3590
17	V	A	0.0000
18	F	A	-0.2780
19	A	A	-0.6292
20	N	A	-1.5593
21	K	A	-1.6978
22	N	A	-2.5952
23	A	A	-1.7308
24	N	A	-1.4208
25	G	A	0.0000
26	L	A	-2.0164
27	D	A	-2.1612
28	F	A	0.0000
29	L	A	0.0000
30	V	A	0.0000
31	A	A	-1.4971
32	L	A	0.0000
33	F	A	0.0000
34	E	A	-2.7818
35	K	A	-2.8056
36	F	A	-1.8568
37	P	A	-2.1599
38	D	A	-2.7647
39	S	A	0.0000
40	A	A	0.0000
41	N	A	-2.3970
42	F	A	-0.1835
43	F	A	-0.1701
44	A	A	-0.2789
45	D	A	-1.0657
46	F	A	0.0000
47	K	A	-2.7676
48	G	A	-2.2873
49	K	A	-2.4188
50	S	A	-1.7237
51	V	A	-1.3046
52	A	A	-1.2655
53	D	A	-2.2107
54	I	A	0.0000
55	K	A	-2.7138
56	A	A	-1.4617
57	S	A	-1.8162
58	P	A	-1.9335
59	K	A	-2.6948
60	L	A	0.0000
61	R	A	-3.7920
62	D	A	-3.6355
63	V	A	0.0000
64	S	A	0.0000
65	S	A	-2.5087
66	R	A	-2.7607
67	I	A	-1.3531
68	F	A	0.0000
69	T	A	-1.7435
70	R	A	-2.5195
71	L	A	0.0000
72	N	A	-1.9757
73	E	A	-2.9802
74	F	A	0.0000
75	V	A	0.0000
76	N	A	-2.6602
77	N	A	0.0000
78	A	A	0.0000
79	A	A	-1.2836
80	N	A	-1.7210
81	A	A	-1.1642
82	G	A	-1.5353
83	K	A	-2.3193
84	M	A	0.0000
85	S	A	-1.0185
86	A	A	-0.8205
87	M	A	-1.2044
88	L	A	-0.8587
89	S	A	-1.0461
90	Q	A	-1.7723
91	F	A	-1.1429
92	A	A	0.0000
93	K	A	-2.0527
94	E	A	-1.1442
95	H	A	-0.3312
96	V	A	-0.2512
97	G	A	-0.0263
98	F	A	1.5311
99	G	A	0.6803
100	V	A	0.6587
101	G	A	-0.4193
102	S	A	0.0000
103	A	A	-1.0127
104	Q	A	-1.0535
105	F	A	-1.3522
106	E	A	-2.3371
107	N	A	-1.8174
108	V	A	0.0000
109	R	A	-2.0594
110	S	A	-1.5000
111	M	A	0.0000
112	F	A	0.0000
113	P	A	-1.0071
114	G	A	-0.7933
115	F	A	0.0000
116	V	A	0.0000
117	A	A	-0.2124
118	S	A	0.0149
119	V	A	0.4218
120	A	A	0.2415
121	A	A	0.0746
122	P	A	-0.6678
123	P	A	-0.6396
124	A	A	-0.3768
125	G	A	-0.9276
126	A	A	0.0000
127	D	A	-2.0213
128	A	A	-1.1300
129	A	A	0.0000
130	W	A	0.0000
131	T	A	-1.3641
132	K	A	-1.3628
133	L	A	0.0000
134	F	A	0.0000
135	G	A	-1.1915
136	L	A	-0.6025
137	I	A	0.0000
138	I	A	0.0000
139	D	A	-2.2620
140	A	A	-1.7326
141	L	A	0.0000
142	K	A	-2.3771
143	A	A	-1.5730
144	A	A	-1.5990
145	G	A	-1.3682
146	A	A	-1.0246