Project name: 87a050dcd736536

Chain sequence(s)	A: SFMLTQPPSVSGSPGRTVAISCTRTSGSIASGFVHWYQQRPGSPPIVLIFENDQRSAGVSERFSGSLDSSSNTATLTISGLGIEDEAHYHCQSFERMRFVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)

• Minimal score value: -2.5891
• Maximal score value: 1.7064
• Average score: -0.4293
• Total score value: -47.2261

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.4959
2	F	A	0.0000
3	M	A	1.0222
4	L	A	0.0000
5	T	A	0.0748
6	Q	A	0.0000
7	P	A	-0.4774
8	P	A	-0.7774
9	S	A	-0.7618
10	V	A	-0.3187
11	S	A	-0.0598
12	G	A	-0.2027
13	S	A	-0.0748
14	P	A	-0.3711
15	G	A	-1.5132
16	R	A	-2.3930
17	T	A	-1.3632
18	V	A	0.0000
19	A	A	-0.0170
20	I	A	0.0000
21	S	A	-0.0997
22	C	A	0.0000
23	T	A	-0.3034
24	R	A	-0.2172
25	T	A	-0.0991
26	S	A	-0.4179
27	G	A	-0.7720
28	S	A	-0.6795
29	I	A	0.0000
30	A	A	-0.1175
31	S	A	-0.2349
32	G	A	0.1391
33	F	A	0.9110
34	V	A	0.0000
35	H	A	0.0280
36	W	A	0.0000
37	Y	A	0.7343
38	Q	A	0.0000
39	Q	A	-1.0973
40	R	A	-1.9467
41	P	A	-1.3186
42	G	A	-0.9928
43	S	A	-0.7356
44	P	A	-0.3533
45	P	A	0.0500
46	I	A	1.3513
47	V	A	1.3368
48	L	A	0.0000
49	I	A	0.0000
50	F	A	-0.5721
51	E	A	-1.3105
52	N	A	-1.3131
53	D	A	-2.5891
54	Q	A	-2.4379
55	R	A	-1.9767
56	S	A	-0.7908
57	A	A	-0.6044
58	G	A	-0.6906
59	V	A	-0.5994
60	S	A	-1.2361
61	E	A	-2.2550
62	R	A	-1.5529
63	F	A	0.0000
64	S	A	-1.4403
65	G	A	-1.3326
66	S	A	-1.2209
67	L	A	-0.6729
68	D	A	-1.4446
69	S	A	-1.0658
70	S	A	-0.8699
71	S	A	-0.8709
72	N	A	-0.9932
73	T	A	-0.7601
74	A	A	0.0000
75	T	A	-0.5255
76	L	A	0.0000
77	T	A	-0.2789
78	I	A	0.0000
79	S	A	-1.4321
80	G	A	-1.6030
81	L	A	0.0000
82	G	A	-0.2907
83	I	A	0.9494
84	E	A	-1.2802
85	D	A	0.0000
86	E	A	-1.3412
87	A	A	0.0000
88	H	A	-1.7177
89	Y	A	0.0000
90	H	A	-0.0800
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	F	A	0.7311
95	E	A	-0.7007
96	R	A	-1.5910
97	M	A	-0.1776
98	R	A	-0.7271
99	F	A	1.5433
100	V	A	1.4260
101	F	A	1.7064
102	G	A	0.4748
103	G	A	-0.2867
104	G	A	-0.6808
105	T	A	0.0000
106	K	A	-1.7642
107	L	A	0.0000
108	T	A	-0.0208
109	V	A	0.0000
110	L	A	1.6049