Project name: 9757434e31bbd8 [mutate: GD335A]

Chain sequence(s)	A: MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GD335A
Energy difference between WT (input) and mutated protein (by FoldX)	3.38986 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:10)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)

• Minimal score value: -3.5898
• Maximal score value: 2.3787
• Average score: -0.416
• Total score value: -20.7976

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
311	M	A	0.8354
312	N	A	0.0873
313	F	A	1.5762
314	G	A	1.1795
315	A	A	1.4286
316	F	A	2.3787
317	S	A	1.5757
318	I	A	1.7520
319	N	A	-0.0234
320	P	A	0.1887
321	A	A	0.5136
322	M	A	1.1834
323	M	A	1.0231
324	A	A	0.5737
325	A	A	0.6202
326	A	A	0.6558
327	Q	A	0.2127
328	A	A	0.1545
329	A	A	0.3162
330	L	A	0.8386
331	Q	A	-0.1217
332	S	A	0.0876
333	S	A	0.3833
334	W	A	0.9741
335	D	A	0.1401	mutated: GD335A
336	M	A	1.2294
337	M	A	1.3289
338	G	A	0.4703
339	M	A	0.7759
340	L	A	0.2327
341	A	A	-0.5688
342	S	A	-0.9404
343	Q	A	-1.9950
344	Q	A	-2.8134
345	N	A	-2.7223
346	Q	A	-2.5992
347	S	A	-2.2645
348	G	A	-1.6497
349	P	A	-1.4870
350	S	A	-1.3416
351	G	A	-2.2234
352	N	A	-3.1851
353	N	A	-3.0938
354	Q	A	-3.5898
355	N	A	-3.1841
356	Q	A	-3.0762
357	G	A	-2.6547
358	N	A	-2.1556
359	M	A	-0.4648
360	Q	A	-1.3593